KEGG   Mycobacterium marinum E11: MMARE11_43850Help
Entry
MMARE11_43850     CDS       T04774                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mmae00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    MMARE11_43850
Enzymes [BR:mmae01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MMARE11_43850
DNA repair and recombination proteins [BR:mmae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MMARE11_43850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CDM78522
LinkDB All DBs
Position
complement(5312865..5315177)
Genome map
AA seq 770 aa AA seqDB search
MGSAQAWPPGQANGPQVTLTNADKVLYPATGTTKSDVFGYYTGIAEVMIPHIAGRPATRK
RWPNGVDQASFFEKQLASSAPDWLPRASVVHRSGTTTYPIIDSPTGLAWIAQQAALEVHV
PQWRFVAEWTSKGEILTPGPATRLVFDLDPGEGVTMAQLAQVARAVRDLLADIGLSTLPL
TSGSKGLHLYTPLDEPVSSKGATVLAKRVAQQLETVMPALVTATMTKSLRAGKVFLDWSQ
NSGSKTTIAPYSLRGREQPTVAAPRSWEELDDPGLRQLTYDEVLARLTRDGDLIAALDAD
LPGDDRLLKYRSMRNASKTPEPVPRARPVVGQGNTFVIQEHHARRLHYDFRLERDGVLVS
WAVPKNLPETTSVNHLAVHTEDHPLEYATFEGNIPKGEYGAGKVIIWDSGTYDTEKFRDD
SRNGSEKGEVIVNLHGSRISGRYALIQTNGDQWLAHRMKDQTVFDFDTLAPMLTSHGSVA
GLESGQWAFEGKWDGYRLLVEADHGALRLRSRSGRDVTAEYPQLRSLAADLADHHVVLDG
ELVALDSSGVPSFNEMQNRVRATRIEFWAFDLLFLDGRSLLRARYRDRRKLLETLGSAGN
LIVPELLPGDGAEALAYSHKRGWEGVIAKRRDSGYQPGRRSSAWIKDKHWNTQEVVIGGW
RVGEGGRSSGIGSLLMGIPGPSGLHFAGRVGTGFTERDLANLKKTLAPLHTDESPFDAAL
PAREAKGVTFVAPTLVGEVRYSEWTPDDRLRQSSWRGLRPDKNPSEVVRE
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggcgcaggcctggcctcctggacaggcgaatggtccgcaggtgacgctgacc
aacgcggacaaggtgctgtacccggctaccggaaccaccaagtctgacgtcttcggttac
tacaccggcatcgccgaggtgatgatcccgcatatcgccgggcgcccggcgactcgcaag
cgctggcccaacggcgtcgatcaggcgtcctttttcgaaaagcagctggcgtcgtcggcg
ccggactggctgccgcgtgccagcgtggtgcaccggtcgggaacgacgacctatccgatc
atcgacagccccaccggcctggcctggatcgcacaacaggccgccctcgaggtgcacgtc
ccgcagtggcggttcgttgccgagtggacgtcgaaaggcgaaatcctcacgcccgggccg
gccacccgattggtgttcgacctggacccgggcgagggcgtgacgatggcccaactcgcg
caggtggcgcgggcggtgcgcgatctgctcgccgacatcggcctgagtaccctcccgctc
accagcggtagcaagggcctgcacctctacaccccgctcgacgagccggtgagcagcaag
ggcgccacggtgttggccaaacgggtcgcgcagcaactggaaacggtgatgccggcgttg
gtcaccgcgaccatgaccaagagtctgcgggccgggaaagtgttcctggactggagccaa
aacagcggttcgaagaccaccatcgcgccgtattcgctgcgtgggcgcgaacaaccgacc
gtcgccgcaccacgcagctgggaggagctcgacgacccggggctgcgccagctgacctac
gacgaggtgcttgcccgcctcacccgcgatggcgatctgattgcggcgctggacgcggac
ctccccggcgacgaccggctgctcaaatatcgcagcatgcgcaacgcgtcgaaaacgccg
gagcccgtgccccgagccagacccgttgtcgggcagggtaataccttcgtgatccaagag
catcacgcgcgccgtctgcattacgacttcaggctggagcgtgatggggtactggtgtca
tgggcggtgccgaaaaacctgccggaaaccacgtcggtgaaccacctggccgtgcacacc
gaagatcatccgctggaatacgcgacgttcgagggcaacatcccgaaaggggagtacggc
gccggcaaggtgatcatctgggattccggcacctatgacaccgagaagttccgcgacgac
tcgagaaacggttcggaaaagggggaggtgattgtcaacctgcacggcagtcgaatctcg
gggcggtacgcgctgattcagaccaacggggaccaatggctggcgcatcgcatgaaggac
cagacggtcttcgatttcgacaccctcgcgcccatgctcacctcccacggttcggtggca
ggtctcgagtcgggtcagtgggcgttcgaaggcaagtgggacggctaccggctgctggtc
gaagccgaccatggcgcgctgcgactgcgctcccgcagcggacgtgacgtcaccgcggaa
tacccccaattacgttcattggccgccgatctcgctgatcaccacgtggtgctcgacggt
gaattggtggccctcgactcctccggagtgcccagcttcaacgagatgcagaaccgggtg
cgcgccacccgcatcgagttctgggcgttcgacttgctctttctggacggtcgctcgcta
ctgcgggccagataccgcgaccggcgcaagctactggaaaccctgggcagtgcgggcaat
ctgatcgttccggagttgttgcccggtgacggcgccgaggcgctggcctattcgcacaag
cgcggttgggagggagtcattgccaagcgccgcgactccggctatcaacccgggcggcgc
tcgtcggcgtggatcaaggacaaacactggaacacccaggaagtcgtcatcggcggttgg
cgagttggggagggtgggcgcagcagcgggattggatcgttgctcatgggcattcccggc
ccgagcggtttgcacttcgccggccgtgttggaaccggcttcaccgaacgtgacctggct
aacctcaagaagacgctggcgccgctgcataccgacgaatccccattcgacgctgcgctt
ccggcgcgcgaggccaagggtgttacgttcgtcgcgccgacgctggtcggggaggtgcgc
tatagcgagtggacccccgatgaccgattgcggcaatccagctggcgtgggttgcgcccg
gacaaaaacccgagtgaggtggtgcgcgaatga

DBGET integrated database retrieval system