KEGG   Methylocaldum marinum: sS8_0817Help
Entry
sS8_0817          CDS       T05638                                 

Definition
(GenBank) aldehyde dehydrogenase (NAD) family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00010  Glycolysis / Gluconeogenesis
mmai00053  Ascorbate and aldarate metabolism
mmai00071  Fatty acid degradation
mmai00280  Valine, leucine and isoleucine degradation
mmai00310  Lysine degradation
mmai00330  Arginine and proline metabolism
mmai00340  Histidine metabolism
mmai00380  Tryptophan metabolism
mmai00410  beta-Alanine metabolism
mmai00561  Glycerolipid metabolism
mmai00620  Pyruvate metabolism
mmai00625  Chloroalkane and chloroalkene degradation
mmai01100  Metabolic pathways
mmai01110  Biosynthesis of secondary metabolites
mmai01120  Microbial metabolism in diverse environments
mmai01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sS8_0817
   00053 Ascorbate and aldarate metabolism
    sS8_0817
   00620 Pyruvate metabolism
    sS8_0817
  09103 Lipid metabolism
   00071 Fatty acid degradation
    sS8_0817
   00561 Glycerolipid metabolism
    sS8_0817
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sS8_0817
   00310 Lysine degradation
    sS8_0817
   00330 Arginine and proline metabolism
    sS8_0817
   00340 Histidine metabolism
    sS8_0817
   00380 Tryptophan metabolism
    sS8_0817
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sS8_0817
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    sS8_0817
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    sS8_0817
Enzymes [BR:mmai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     sS8_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BBA32782
UniProt: A0A250KML2
LinkDB All DBs
Position
complement(893046..894524)
Genome map
AA seq 492 aa AA seqDB search
MSAEPKQINPSEIKISQTKMLIDGKWVDSASGKTFETLNPATGEVIARVAEGDREDVDRA
VRAARKAFEEGPWRKMNARERGRCLYRLADLIEKHFDELAALETLNNGKPISESRSADLP
LTIECYRYYAGWADKIEGKTIPINGPFFTYTRHEPVGVVGQIIPWNFPLLMQAWKWGPAL
AAGCTIVLKPAEQTPLTALRVGELALEAGIPEGVINIVPGFGETAGAAVAEHMDIDKVAF
TGSTEVGKLIMQAAGRSNLKRVTLELGGKSPNIIFADSDLDAALEGAFQGLFFNQGQCCC
AGSRVFVENNIYGDFAERLVERTRKQVVGDPFDPRTTQGPQVSQEQFDQVMGYIRSGKDQ
GAKLLTGGNPIGNRGFFIEPTIFADVGEDMRIAREEIFGPVLSMIPFKDVDEVIGHGNRT
MYGLAAAVWTKDINKAHRLAAELKAGTVWINCYDIFDTAAPFGGYKMSGIGRELGSYALE
NYTEVKTVTVAL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcggaacccaaacagatcaacccgtccgaaatcaaaatctctcaaaccaagatg
ctgatcgacggcaagtgggtcgattcggcgagcggaaagaccttcgaaacgctcaacccg
gcgaccggcgaggtgatcgcccgtgtcgcggaaggcgaccgcgaggacgtggatagggcc
gttcgcgccgcccgcaaggctttcgaggaaggcccgtggcggaaaatgaacgcgcgcgaa
cgggggcgctgcctgtaccgcctggcggatttgatcgagaaacacttcgacgaattggcg
gcgctggaaacgctcaacaacggcaaaccgatcagcgagagccgatcggccgacctgccg
ctcacgatcgagtgttaccgctattacgctggctgggcggacaagatcgagggcaagacc
attccgatcaacggcccgttcttcacctacacccgccatgaaccggtcggcgtggtgggc
caaatcattccctggaattttccgctcctgatgcaggcctggaaatggggcccggcgctc
gcggccggctgcaccatcgtgctcaagcccgccgagcaaacgccgctgaccgcgctcagg
gtgggcgaactggctctcgaggccggcattccggaaggcgtcatcaatatcgtgccggga
ttcggcgagaccgccggagccgcggttgccgaacacatggacatcgacaaggtggctttc
accggatcgaccgaagtcggcaagctcatcatgcaggccgccggacgctcgaacctgaag
cgcgtcaccctggaactgggcggaaaaagcccgaacatcatcttcgccgattccgatctg
gacgcggcgctcgaaggcgcgttccagggactgttcttcaaccaggggcagtgctgctgc
gccggctctcgcgtttttgtggaaaacaacatttacggggacttcgccgaaaggctggtc
gaacggacccgcaagcaggtcgtgggcgacccgttcgatccgagaaccacccagggacca
caggtcagccaggagcagttcgatcaggtcatgggctatatccgctccggcaaggatcaa
ggcgccaagcttttgaccggcggcaacccgatcggcaaccggggctttttcattgaaccc
acgattttcgccgacgtcggcgaagacatgagaatcgcgcgcgaggaaatcttcggaccg
gtgctgtcgatgatcccgttcaaggacgtggatgaagtcatcggacacggcaaccggacc
atgtatggcctggcggccgcggtatggaccaaggacatcaacaaggcgcatcgcctggcc
gcggagctgaaggcgggaacggtgtggatcaattgctacgacatcttcgatacggccgcg
cctttcggcgggtataagatgtccggcatcggacgcgaactcggtagctacgccctggag
aactataccgaggtcaagaccgtcacggtggcgttgtaa

DBGET integrated database retrieval system