KEGG   Methylocaldum marinum: sS8_2350Help
Entry
sS8_2350          CDS       T05638                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00061  Fatty acid biosynthesis
mmai00780  Biotin metabolism
mmai01100  Metabolic pathways
mmai01212  Fatty acid metabolism
Module
mmai_M00083  Fatty acid biosynthesis, elongation
mmai_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    sS8_2350
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    sS8_2350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmai01004]
    sS8_2350
Enzymes [BR:mmai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     sS8_2350
Lipid biosynthesis proteins [BR:mmai01004]
 Fatty acid synthase
  Component type
   sS8_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT
Motif
Other DBs
NCBI-ProteinID: BBA34302
UniProt: A0A250KRV8
LinkDB All DBs
Position
2624587..2625063
Genome map
AA seq 158 aa AA seqDB search
MLSSIPEEGKAPLDIQKIKEYLPHRYPFLLVDRVLEVEPGKRLLAYKNVTYNEPFFTGHF
PELPIMPGVLIIEALAQTTGLLASETAPDVLGKGMVYYLVGLDKVRFKRPVVPGDRLMLE
ATYLRHKRNIWAFSCRAEVDGEFVASAEIMCAAAEQES
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgctctcatccattcccgaagaaggaaaagcgcctttggatattcaaaaaataaaagag
tatctacctcatcgatatccttttctcctcgtggatcgggttctcgaagtagagcccgga
aagcggctactggcttacaagaacgtaacctataacgaaccgttcttcaccggacatttt
ccggaattgccgatcatgcccggggttctgatcatcgaggcgctagctcaaaccaccggc
ttgctcgcttcggagactgcaccggatgttttgggaaaaggaatggtttactatctcgtc
ggcctggataaagttcgattcaagcgtcctgtcgttccgggagatcgcctgatgttggaa
gcgacctacctgcgccacaagcggaatatctgggcgttttcctgccgcgccgaggtcgac
ggagaatttgtagccagtgcggaaatcatgtgcgcggcggcggagcaggagtcttga

DBGET integrated database retrieval system