KEGG   Methylocaldum marinum: sS8_3500Help
Entry
sS8_3500          CDS       T05638                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00380  Tryptophan metabolism
mmai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    sS8_3500
Enzymes [BR:mmai01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     sS8_3500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BBA35437
UniProt: A0A250KUZ5
LinkDB All DBs
Position
complement(3833456..3834904)
Genome map
AA seq 482 aa AA seqDB search
MSFEAHRSLAEAMDRADALGSYRDCFHIPKREDGSEEIYFCGNSLGLQPKSARSYAEEVL
AAWARMGVRGHFEGDRPWLPYHEFATEKLARLVGALPVETAAMNSLTVNLHLLMVSFYRP
TPERHKILIEEHAFPSDRYAVASQIAFHGFDPDESLIEAKARPGEAALRTADVLDLIERE
GDGIALILWPGLQFYTGQAFAMAEIAESGHRKGCVVGFDLAHAVGNLVLKLHDWNADFAV
WCSYKYLNAGPGAVAGCFVHERHAERFDLPRFAGWWGHDKSTRFVMPPRFNPLPGAEGWQ
LSNPPILSLAPLLASLDLFDQAGMDALRAKSESLTGYLEALLNERCGDRITILTPSESNA
RGCQLSIRLKGDGGHTPAPCPHPLPLSKTLTRPSPKGRGRFEVRERGVQVPRPLGEGFRV
REKDLCFDKPGKEVYDALIASGIACDWREPDVIRVAPVPFYNRYAEVFDFVERLEGVLDD
EG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgaagcccaccgatcactcgccgaagcgatggaccgcgccgacgcgctcggt
tcctaccgggattgcttccatattccgaagcgcgaagacggctcggaagagatttatttc
tgcggcaactccctgggacttcagccgaaatcggcgcggagctacgcggaggaggtgctg
gccgcgtgggcgcggatgggggtgcggggccacttcgagggagatcgtccctggctgcct
taccatgaattcgcgaccgagaagctggcccggctggtgggcgccctgccggtcgaaacg
gcggcgatgaactcgctgacggtcaacctgcatcttctgatggtgagcttttaccgtccg
acgccggaacgccacaaaatcctgatcgaggagcacgctttcccctcggaccgctacgcc
gtggcatcccagatcgcctttcacggcttcgatccggacgaatcgctgatcgaggccaag
gcacgtccgggcgaggcggcgctacgcacggcggacgtattggatctcatcgaacgggaa
ggcgacggcatcgcgctaatcctgtggccgggccttcagttctacacgggacaagccttc
gccatggccgaaatcgccgagagcgggcaccggaaaggctgcgtggtcggtttcgacctg
gcccacgccgtgggcaatctggtcttgaaactgcacgactggaacgctgatttcgccgtc
tggtgttcctacaaatatctgaacgcgggacccggagcggtcgccggctgcttcgtccac
gagcgccatgccgaacgcttcgatcttccccgcttcgccggctggtggggacacgacaaa
tccacccggttcgtcatgccgccgaggttcaaccccttgcccggcgccgagggctggcag
ctcagcaatccgcctatcctttccctggcacctttgctcgcttcactggatctgttcgat
caggcgggaatggacgcattgcgggcgaagtcggaaagcttgaccggttatctggaggct
ttactgaacgagcgctgtggagaccggatcacgattctcacgccatcggaatccaacgcc
cggggctgccagctttcgatcaggctgaaaggggatggcggacatacgccggccccatgc
cctcaccccctgcccctctccaagaccctcacccgaccctctcccaaagggagagggcgt
tttgaagttcgggagaggggagttcaagtccctcgccctctgggagagggatttagggtg
agggaaaaagacctgtgcttcgacaagccgggcaaggaggtctacgacgccttgatcgcc
tccggaatcgcttgcgattggcgcgaacccgacgtgatccgcgtggcgccggtcccgttt
tacaaccgctacgccgaggtcttcgatttcgtggagcggctcgagggagtactcgacgat
gaaggttaa

DBGET integrated database retrieval system