KEGG   Methylocaldum marinum: sS8_4366Help
Entry
sS8_4366          CDS       T05638                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    sS8_4366
Enzymes [BR:mmai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     sS8_4366
Transporters [BR:mmai02000]
 Other Transporters
  Pores ion channels [TC:1]
   sS8_4366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_C_2 GST_N_3 GST_C GST_C_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: BBA36296
UniProt: A0A250KXP3
LinkDB All DBs
Position
complement(4725997..4726629)
Genome map
AA seq 210 aa AA seqDB search
MMNGNRQVTLFHAPNTRSLGALALLEELGADYRLKVLDLKAGEQRKPEFLAINPMGKVPA
LLHADAVVTELVAIYIYLADLYAESGLAPGIGNPLRGPYLRWLVFYGSCFEPALVDKRLK
REPPPRSTSPYGDYETMLKTLSDQLAKGPYILGEKFTAADVLWSIALSWSVAFKLVPKSP
PIRAYIDRINLRPAVERARAKDAEPAAAQR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacggaaaccgtcaagttaccctgtttcacgctcccaacacccgctccctcggt
gctctcgccctgctcgaagaactcggcgccgattaccggctcaaggtgctcgatctgaaa
gcgggcgagcaacgcaagccggaatttttggccatcaaccccatgggcaaggtgcccgcc
ctgttgcacgctgatgccgtggtcaccgaactggtggccatctatatctatctcgccgac
ctttatgcggaatcgggactggcgcccggcattggcaatccgctgcgcggcccctacctg
cgctggctggtgttttacggctcctgtttcgaaccggccctggtggacaaaaggttgaag
cgcgagccgccgccgcgctcgacctcgccctacggcgattacgagaccatgttgaagacg
ctgagcgatcagctcgcaaaaggaccttacatcctgggcgagaagttcaccgccgcggat
gtgctgtggagcatcgcgctctcttggtccgtggcgttcaagctcgtgccgaagtcaccg
ccgatcagggcctacatcgatcgcatcaatctgcggccggcggtggaacgggccagggcc
aaggatgccgaaccggccgcggcgcagcgctaa

DBGET integrated database retrieval system