KEGG   Methylocaldum marinum: sS8_4965Help
Entry
sS8_4965          CDS       T05638                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00061  Fatty acid biosynthesis
mmai00780  Biotin metabolism
mmai01100  Metabolic pathways
mmai01130  Biosynthesis of antibiotics
mmai01212  Fatty acid metabolism
Module
mmai_M00083  Fatty acid biosynthesis, elongation
mmai_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    sS8_4965
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    sS8_4965
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    sS8_4965
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mmai01004]
    sS8_4965
Enzymes [BR:mmai01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     sS8_4965
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     sS8_4965
Lipid biosynthesis proteins [BR:mmai01004]
 Fatty acid synthase
  Component type
   sS8_4965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BBA36888
UniProt: A0A250KYX7
LinkDB All DBs
Position
complement(5390499..5391281)
Genome map
AA seq 260 aa AA seqDB search
MGFMQDKRALIVGVASNRSIAYGIAEAMRREGAEIALTYQNDKLKERVEKLAEDLGAKIV
LPCDVASDEQIDTLFDELGKRWDGLDCIVHSVAFAPREALEGSYLDSVTRENFRIAHDIS
SYSFAALAKGGRKLLAGRNGSLLTLSYLGAERVIPNYNVMGIAKASLEASVRYLATSLGP
EGIRVNAVSAGAIRTLAASGIANFREMLAKGEQASPLRKNVTIEEVGNAAAFLCSDLASG
ITGEILYVDAGYNIVGLSGI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcatgcaagacaagcgtgctcttatcgtcggcgtcgccagcaatcgctccatc
gcctacggcatcgctgaggccatgcggcgcgagggggcggaaatcgcgctgacctatcaa
aacgacaaactcaaggagcgcgtcgaaaaactggccgaggacttgggcgccaaaatcgtg
ctgccctgcgacgtggcgagcgacgagcagatcgacacgcttttcgacgaattgggcaaa
cgctgggacggcctcgactgcatcgtccattccgttgccttcgccccgcgcgaagccctg
gaaggctcttatctcgactcggtaacccgcgaaaacttccgcattgcccacgacatcagt
tcctatagcttcgccgcgctcgcgaaaggcggccgcaagctgttggcgggccgcaacggc
tctttgttgacactgagttatctcggcgccgagcgggtgattccgaattacaacgtgatg
ggcatcgccaaggccagcctcgaagccagtgtccgttacctggcaacatccctcggcccg
gaaggcatccgcgtcaacgccgtctccgcaggcgccatacgcaccctcgccgcctccggc
atcgccaatttccgcgagatgctggccaagggcgaacaagcctcgcctttgcgcaagaac
gtcaccatcgaagaagtgggcaacgccgccgcgttcctctgctccgacctcgcgtccggc
atcaccggggaaatcctctacgtggacgccggctacaacattgtcggactctccgggatc
tga

DBGET integrated database retrieval system