KEGG   Methylocaldum marinum: sS8_5323Help
Entry
sS8_5323          CDS       T05638                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
mmai  Methylocaldum marinum
Pathway
mmai00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmai01100  Metabolic pathways
mmai01110  Biosynthesis of secondary metabolites
mmai01130  Biosynthesis of antibiotics
mmai01230  Biosynthesis of amino acids
Module
mmai_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mmai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sS8_5323
Enzymes [BR:mmai01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     sS8_5323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH DUF3866
Motif
Other DBs
NCBI-ProteinID: BBA37243
UniProt: A0A250KZY5
LinkDB All DBs
Position
5732575..5733657
Genome map
AA seq 360 aa AA seqDB search
MKTLTVSLDERSYPIYIGSRILESGEILARHLSSSQVMVVTNETVAPLYLDKVKQCLQGK
QSAAVILPDGESYKSMESAMTIFDGLLAGKFSRDACIVALGGGVIGDLTGFAAACYQRGV
PFIQIPTTLLAQVDSSVGGKTAVNHPRGKNMIGAFYQPLCVLADTSTLDTLADRELSAGL
AEVIKYGLIRDFAFFVWLEANIEALLARDADSLAYAIERSCLNKAEVVAEDERESGVRAT
LNLGHTFGHAIETGMGYGTYLHGEAVAIGMCQAADLSRRLGWLDEDSVERIVSLLRRARL
PVKPPVDLAVERYLDLMAVDKKNVAGELRLILLEKIGQASLPMEVDLELLRATLSEYGRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccctaaccgtcagcctggacgaacgcagctatccgatctatatcggttcacga
atcctggaatccggagaaatactcgctaggcacctcagttccagccaagtcatggtagtt
accaacgaaaccgtggcacctctctatctggataaagtgaaacaatgcttgcaaggcaag
cagtctgccgcggtgattttaccggacggcgagtcttacaaaagcatggaatcggcgatg
accattttcgacggcctgcttgccggaaaattcagccgagacgcatgtatcgtcgctctg
gggggcggagtgatcggtgatctgacgggtttcgccgccgcatgttatcaacggggcgta
ccttttattcaaattccgacgaccttgctggcacaggtggactcttccgtgggcgggaaa
accgcggtcaatcatccgcgcggcaagaatatgattggagcgttttatcagccgttatgt
gttctggccgatacctcgacgctggacaccttggccgacagggaacttagcgcgggcttg
gccgaagtcatcaagtatggactgatccgcgattttgcattcttcgtctggctggaggcc
aatatcgaggcgctgctggctcgcgatgccgatagcctcgcctacgccatcgagagatcc
tgcctcaataaagcggaggttgtggccgaagacgagcgggaatcgggagtgcgtgcaacg
ctgaatttagggcatactttcggccacgccatagagaccggcatgggttatggtacgtat
ttgcacggtgaagcggtagccatcggaatgtgtcaggcggcagatctctcacgccggctc
ggctggctggatgaggatagcgtcgaacgtatcgtttcgctgctcaggcgggctagactg
ccggtcaagccgccagtcgatttggcggttgagcgctacctggatttaatggcggttgac
aagaagaacgtggcaggcgagctgcgcttgattctgctggaaaaaatcggtcaggcgagc
ttgcccatggaggttgatctcgaattgcttcgagcgacattgagtgagtatgggcgcgtt
tga

DBGET integrated database retrieval system