KEGG   Mycobacterium marseillense: CKJ54_01520Help
Entry
CKJ54_01520       CDS       T05049                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmal  Mycobacterium marseillense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ASW88717
UniProt: A0A249B2U2
LinkDB All DBs
Position
complement(307495..308577)
Genome map
AA seq 360 aa AA seqDB search
MDLAVMPPVSPMLAKSVRSIPPDASYEPKWDGFRSICFRDGDDVELGSRNERPMTRYFPE
LVAAVKAELPPRCVIDGEIVISTTRATGTRLDFEALQQRIHPADSRVRMLAEATPASFIA
FDLLALGDDDYTRRPFSERRAALVDAVGGPGHSIHVTPATTDLSTAQRWFDEFEGAGLDG
VIAKPLDVTYQPDKRVMFKIKHERTADCVVAGYRVHKSGADAIGSLLLGLYQDDGQLASV
GVIGAFPMAERRRLFAELQALVTDFTDHPWNWAAHEAGERTPRKNEYSRWNAGKDLSFVP
LRPERVVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYEQLEQPVTFSLGEIVPGLGPG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacctcgctgtcatgccgccggtgtcgccgatgctggccaagtcggttcgctcgatt
ccgcccgacgcgtcgtatgagcccaagtgggacggattcaggtcgatctgcttccgcgac
ggcgacgacgtcgagctgggcagccgcaacgagcggccgatgacccgctacttcccggag
ttggtcgccgccgtcaaggccgagctgccgccgcgctgcgtgatcgacggggagatcgtc
atatccactacgcgagccaccggcaccagattggacttcgaggcgctgcaacagcgcatc
cacccggccgactcgcgggttcggatgctggccgaggcgacacccgcgtccttcatcgcg
ttcgacctgctggcgctcggcgacgacgactacacccggcggccgttcagcgagcggcgg
gcggccctcgtcgatgcggtgggcgggccggggcattcgatccatgtcacgcccgccacg
accgatctgagcaccgcgcagcggtggttcgacgagttcgagggtgccggcctcgatggc
gtgatcgccaagcccctggacgtcacctaccagccggacaagcgggtcatgttcaagatc
aagcacgaacggaccgcggactgcgttgtcgccggctaccgggtgcacaagtccggcgcc
gacgcgatcgggtcgctgctgctggggctctaccaggatgatgggcagctggcgtcggtc
ggcgtcatcggcgccttcccgatggccgagcggcgccggctgttcgccgaactgcaggcg
ctcgtcaccgacttcaccgatcacccgtggaactgggccgcccacgaagccggcgagcgg
acgccccgcaagaacgaatactcgcggtggaacgccggtaaggatctctcctttgtgccg
ctgcgccccgagcgtgtggtcgaggtccgctacgaccacatggaggggcggcggtttcgt
cataccgcgcagttcaacaggtggcgcccggaccgcgacccgcgctcgtgcacctacgag
cagctggaacagccggtgacgttcagtctcggcgagatcgtgccgggccttggcccgggc
tag

DBGET integrated database retrieval system