KEGG   Mycobacterium marseillense: CKJ54_04220Help
Entry
CKJ54_04220       CDS       T05049                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00071  Fatty acid degradation
mmal00280  Valine, leucine and isoleucine degradation
mmal00281  Geraniol degradation
mmal00310  Lysine degradation
mmal00362  Benzoate degradation
mmal00380  Tryptophan metabolism
mmal00410  beta-Alanine metabolism
mmal00640  Propanoate metabolism
mmal00650  Butanoate metabolism
mmal00903  Limonene and pinene degradation
mmal00930  Caprolactam degradation
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
mmal01130  Biosynthesis of antibiotics
mmal01200  Carbon metabolism
mmal01212  Fatty acid metabolism
Module
mmal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKJ54_04220
   00650 Butanoate metabolism
    CKJ54_04220
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKJ54_04220
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKJ54_04220
   00310 Lysine degradation
    CKJ54_04220
   00380 Tryptophan metabolism
    CKJ54_04220
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKJ54_04220
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKJ54_04220
   00281 Geraniol degradation
    CKJ54_04220
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKJ54_04220
   00930 Caprolactam degradation
    CKJ54_04220
Enzymes [BR:mmal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CKJ54_04220
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKJ54_04220
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CKJ54_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C adh_short_C2 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ASW89196
LinkDB All DBs
Position
826020..828164
Genome map
AA seq 714 aa AA seqDB search
MAENTIQWDKDADGIVTLTLDDPTGSANVMNEHYSESMHNAVERLAAEKESITGVVITSA
KKTFFAGGDLKGMINLGPENAGEAFDTVESVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADVKGSVLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFMNILSQGTRFKPAK
AKEIGLVDELVGSVEELVPAAKAWIKANPDSHEQPWDKKGYKMPGGTPASPALAANLPAF
PALLKKQLKGAPMPAPRAILDAVVEGAQVDFDTASRIESRYFTSLVTGQVAKNMIQAFFF
DLQHINGGGSRPDGIEPVKINKIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEAAQKGK
GYSEKLEAKALQRGKTTEEKSKALLDRITPAADPAELAGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDQA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
APPLQLSDELNLELMHKIAAATRKGVEDAGGTYEPHPAEAVVEKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLSETFNSGSADIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYSGAGGTGKDAFVARAKELAARYGDRFLPPASLS
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccattcagtgggacaaggacgccgacggcatcgtcaccctgacgctg
gacgaccccaccgggtcggccaacgtgatgaacgagcactacagcgagtccatgcacaac
gccgtcgaacgccttgccgccgagaaggaatcgatcaccggcgtcgtgatcaccagcgcg
aagaagaccttcttcgccggcggtgatctcaagggcatgatcaacctcggcccggagaac
gccggcgaggcgttcgacaccgtcgagtcggtcaagcgcgacctgcgtgcgctggagacc
ctgggcaagcccgtggtggccgccatcaacggcgccgcgctcggcggcggcctggagatc
gcgctggcctgtcaccaccgcatcgccgccgacgtcaagggcagcgtcctgggtctgccc
gaggtgacgctgggcctgctgccgggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaacgcgttcatgaacatcctgtcgcagggcacccgcttcaagccggccaag
gccaaggagatcggtctggtcgacgagctcgtcggctcggtggaggaactggtgcccgcc
gccaaggcgtggatcaaggccaaccccgattcgcacgaacagccttgggacaaaaagggt
tacaagatgccgggcggcaccccggccagcccggcgctggcggcgaacctgccagcgttc
ccggcgctgctgaagaagcaactcaagggcgccccgatgcccgcgccgcgggccatcctg
gacgcggtcgtcgagggtgcgcaggtggacttcgacacggccagccgcatcgaaagccgt
tacttcacgtcgctggtgaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctgcagcacatcaacggcggcggttcccgccccgacggcatcgagccggtcaagatc
aacaagatcggtgtgctgggcgcgggaatgatgggcgccggcatcgcctacgtgtcggcc
aaggccgggtacgaggtggtgctcaaggacgtcagcctcgaggccgcccagaagggcaag
ggctactcggaaaagcttgaggccaaggcacttcagcgtggcaagaccaccgaggagaag
agcaaggcgctgctggaccgcatcaccccggccgccgaccccgccgagctggcgggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtgttccaggaa
atcgaggacatcgtcgagcccaacgcgctgctcgggtcgaacacctccacgctgccgatc
accggtctggcgaccggcgtcaagcggcaggaggacttcatcgggatccacttcttctcg
ccggtggacaagatgccgctggtggaaatcatcaagggcgagaagacctctgaccaggcg
ctggcccgggtgttcgactacacgctggccatcggcaagaccccgatcgtggtcaacgac
agccgcgggttcttcaccagccgggtgatcggcacgttcgtgaatgaggccctggcgatg
ctcggcgagggcgtggccccggccagcatcgagcacgccggttcgcaggccggctacccg
gcgccgccgttgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgcg
gccacccgcaagggcgtcgaggacgccggcggcacctacgagccgcacccggccgaggcg
gtggtcgagaagatgatcgagatcggccggcccagccgtttgaagggtgccggcttctac
gagtacgtggacggcaagcgcacccgcctgtggccgggcctgagcgagacgttcaactcg
ggcagcgccgacattccgttgcaggacatgatcgatcggatgctgttcgccgaggcgctc
gagacgcagaagtgtctggacgagggcgtgctgacctcgaccgccgacgccaacatcggc
tcgatcatgggcatcggcttcccgccgtacaccgggggtagcgcgcagttcatcgtcggc
tactccggtgccggcggcacgggcaaggacgccttcgtggcccgcgccaaggaactggcc
gcccgctacggcgaccgattcctgccgcccgcgtcgctgagctga

DBGET integrated database retrieval system