KEGG   Mycobacterium marseillense: CKJ54_10835Help
Entry
CKJ54_10835       CDS       T05049                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00340  Histidine metabolism
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01230  Biosynthesis of amino acids
Module
mmal_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CKJ54_10835
Enzymes [BR:mmal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CKJ54_10835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ASW90307
LinkDB All DBs
Position
2307217..2307498
Genome map
AA seq 93 aa AA seqDB search
MTQSLAVKTFEDLFAELGERARTRPAGSATVAALDGGVHGLGKKILEEAGEVWLAAEHEP
DDALAEEISQLLYWTQVLMVARGLSLDDVYRKL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaatcgctggccgtgaagaccttcgaggatctgttcgccgaactgggcgagcgt
gcccgcacccggccggccggcagcgcgaccgtcgccgcgctcgacggcggcgtccacggg
ctgggtaagaagatcctcgaggaagccggcgaggtgtggctggccgccgaacacgaaccc
gacgacgcgctggccgaggagatcagccagttgctctactggacgcaggtgctgatggtc
gcccgcgggctgtccctcgacgacgtgtatcggaagctgtga

DBGET integrated database retrieval system