KEGG   Mycobacterium marseillense: CKJ54_13680Help
Entry
CKJ54_13680       CDS       T05049                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmal  Mycobacterium marseillense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ASW90803
UniProt: A0A249B8W0
LinkDB All DBs
Position
2961544..2962542
Genome map
AA seq 332 aa AA seqDB search
MTDFAHLPGAVREELYDEPVPDWYSPTLATLTEDRFSDPHWIFERKFDGMRCLAFRDGDR
VHLLSRNRQPLNGTYPELVDALAAQPVTRFVLDGEVVAFDGRRTSFARLQGRLGLTDPDV
ARASPVHIFFYVFDLLHLDGKSTVAMPLLWRKRLLRKAIDFGDPLRYAPHRVGDGIAAYR
RACERGDEGVIAKRADSTYQSGRSKNWLKFKCIRDQEFVVGGYTSPKGSRVELGALMLGY
YEGGDLIYAGKVGTGFDDATLRRLHARLAPITRDSPPFARGLVREAGAHWVSPEMVVQIG
FSEWTRDGKLRHPRYLGLRTDKEPGDVVRETH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttcgcgcacctgcccggcgcggtgcgcgaggaactgtacgacgagcccgtg
cccgactggtactcgcccacgctggccaccctcaccgaagaccggttttccgatccgcac
tggatcttcgagcgcaagttcgacggcatgcgctgcctggcgttccgcgacggcgatcgg
gtgcacctgttgtcgcgaaatcgtcagccgctcaacggaacctatcccgagttggtggat
gcgcttgccgcccaacccgtcacgaggttcgttctggacggcgaggtggtggccttcgac
ggccgacggaccagcttcgcccggctgcagggacggctgggcctgaccgatcccgacgtg
gcccgggcgtcgccggtgcacatcttcttctacgtcttcgatctgctgcatctcgacggc
aaatccaccgtggcgatgccgctcctctggcgaaaacggctgctgcgcaaggccatcgac
ttcggcgatccgctgcgctatgcgccacaccgagtcggagacggcatcgcggcctaccgg
cgcgcatgtgagcgcggcgacgagggcgtgatcgccaagcgagccgactccacctaccag
agcggtcgctcgaagaactggctgaagttcaaatgcatacgcgatcaggagttcgtggtg
ggcggttataccagccccaagggcagtcgagtggagttgggcgccctgatgctcggctac
tacgagggcggcgatctgatctacgcgggcaaggtcggcaccggattcgacgacgccacg
ctgcgccgcctgcacgcgcgcctggcgccgatcacccgggactcgccgccgtttgcccgc
ggtttggtgcgcgaagccggggcgcactgggtatccccggagatggtggttcagatcggg
ttcagcgagtggacgcgcgatggcaagttgcgccatccgcgctacctcggtctgcgcacc
gacaaggagcccggtgacgtggtgcgggagacgcactga

DBGET integrated database retrieval system