KEGG   Mycobacterium marseillense: CKJ54_14840Help
Entry
CKJ54_14840       CDS       T05049                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00620  Pyruvate metabolism
mmal00680  Methane metabolism
mmal01100  Metabolic pathways
mmal01120  Microbial metabolism in diverse environments
mmal01200  Carbon metabolism
Module
mmal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CKJ54_14840
  09102 Energy metabolism
   00680 Methane metabolism
    CKJ54_14840
Enzymes [BR:mmal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CKJ54_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ASW91009
UniProt: A0A249BBE1
LinkDB All DBs
Position
complement(3256486..3259302)
Genome map
AA seq 938 aa AA seqDB search
MAETPEAPDSTLEPIGAVQRTLVGREATEPMRADIRLLGAILGDTVREQNGQDVFELVER
ARVESFRVRRSEIDRAELARMFDGIDIHQAVPVIRAFSHFALLANVAEDIHRERRRAVHV
AAGEPPQDSTLAATYAKLDEAQLDSATVADALRGAVVAPVITAHPTETRRRTVFVTQHRI
TELMRLHAEGHAETDEGRDIELELRRQVLTLWQTALIRLSRLQITDEIEVGLRYYAAAFF
KVIPQVNAEVRDALRSRWPDADLLGEPMLQPGSWIGGDRDGNPNVTADVVRQATGNAAFT
ALAHYLAELTALEQELSMSARLVSVTPALADLAEGCGEKARADEPYRRAVRVIRARLSAT
SAEILDRTPQQVLDLGLPPYETPAELGADLDTLDESLRGHGSALLADDRLALLREGVRVF
GFHLCGLDMRQNSDAHEEVVGELLAWAGVHPDYRSLPEDERVELLAAELGTRRPLVGDDA
QLSDLARGELGVVRAAADAIKRYGPSAVPNYVISMCRSVSDVLEAAILLKEAGLIDASGP
QPYCPVGISPLFETIDDLHNGATILHAMLELPIYRALVTARDDSQEVMLGYSDSNKDGGY
LASSWAVYRAELALVEVARKTGIRLRLFHGRGGTVGRGGGPSYEAILAQPPGAVNGSLRL
TEQGEVIAAKYAEPQAAQRNLESLLAATLESTLLDVEGLGDAAEPAYAVLDEVAVLAQRA
YAELVHDTPGFVDYFMASTPVSEIGSLNIGSRPTSRKPTESISDLRAIPWVLAWSQSRVM
LPGWYGTGTAFEQWIAAGPQTKDERVGILHDLYQRWPFFRSVLSNLAQVLAKSDLGLAAR
YAELVDDEELRRRVFDKIADEHRRTIAMHKLITGQDNLLADNPALARSVFNRFPYLEPLN
HLQVELLRRYRSGDDDELVQRGILLTMNGLASALRNSG
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacgcccgaagcccccgacagcaccctggaaccgatcggcgccgtccagcgc
accctggtggggcgcgaggcgaccgagccgatgcgcgcggacatccggctgctgggtgcc
atcctgggcgacacggtgcgcgagcagaacgggcaggacgtgttcgagctcgtcgaacgt
gcccgggtggaatcgttccgcgtgcggcgctccgagatcgaccgcgcggaactggcgcga
atgttcgacggcatcgacatccaccaggccgtccccgtcatccgcgcgttcagccacttc
gcgctgctggccaacgtcgccgaggacatccaccgcgagcgccgccgcgcggtccacgtc
gccgccggcgaaccgccacaggacagcaccctggccgccacctacgccaaactcgatgag
gcacaactcgattcggccaccgtggccgacgcgctgaggggcgccgtggtcgctccggtg
atcaccgcgcatcccaccgagacccgccggcgcaccgtcttcgtcacccagcatcggatc
accgagctgatgcggctgcacgccgaggggcacgccgagaccgacgagggccgcgacatc
gaactcgagttgcgccgccaggtcctcacgctgtggcagaccgcgctgatccggctgtcc
cggctgcagatcaccgacgagatcgaggtgggtctgcgctactacgccgccgcgttcttc
aaggtgatcccacaggtcaacgccgaggtccgcgacgccctgaggtcccgctggcccgac
gccgacctgctgggcgagccgatgctgcagcccgggtcctggatcggcggcgaccgcgac
ggcaatccgaacgtgacggccgacgtggtacgccaggccaccggcaacgccgcgttcacc
gcgctcgcgcactacctggccgaactgaccgcgctggagcaggagctgtcgatgtcggcg
cgtctggtctcggtcacccccgcgctggccgacctggccgagggctgcggggagaaggcc
cgcgccgacgagccgtaccggcgggcggtgcgggtgatccgcgcccggctcagcgcgacg
agcgccgagatcctggaccggaccccgcagcaggtgctggacctggggctgccgccgtat
gagaccccggccgaactgggggccgatctcgacaccctcgacgagtcgctgcgcggccac
ggcagcgcgctgctggccgacgatcggctggcgctgctgcgagaaggcgtgcgggtcttc
gggtttcacctgtgcggcctggacatgcggcagaactccgacgcgcacgaagaggtggtc
ggcgagctgctggcctgggccggcgtgcacccggactaccggtcgctgcccgaagacgag
cgcgtcgagctgctggcggccgagctgggcacccgccgcccgctggtcggcgacgacgca
cagctgtccgacctggcacggggcgagctcggcgtggtgcgtgcggccgcggacgccatc
aagcggtacggaccgtccgccgtccccaactacgtgatctcgatgtgccgttcggtctcc
gatgtcctcgaggccgcgatcctgctgaaagaggcggggctgatcgacgcgtccgggccc
cagccctactgcccggtgggcatctccccgctgttcgaaaccatcgacgacctgcacaac
ggcgcgacgatcctgcacgcgatgctggaactgccgatctaccgggcgctggtaacggcg
cgtgatgacagccaggaagtgatgctgggctactcggactccaacaaggacggcgggtac
ctggcgtccagctgggcggtgtaccgggccgagctggcgctggtggaagtcgcgcgcaag
accggaatccggttgcggctcttccacggtcgcggcggcaccgtgggccgcggcggcggg
ccgagctacgaggcgatcctggcgcagccgcccggcgcggtcaatggctcgctgcggctt
accgagcagggtgaggtgatcgccgccaaatacgccgaaccgcaagcggcgcaacgcaat
ctggaaagcctgctggccgctacgctggaatcgacgctgctggacgtcgagggcctgggc
gacgccgcggaaccggcgtacgcggtgctcgacgaggtcgccgtgctggcccagcgcgcc
tatgccgaattggtgcacgacacaccgggtttcgtcgactacttcatggcctcgacgccg
gtcagcgagatcggctcgctgaacatcggcagccggccgacgtcgcgcaaacccaccgag
tcgatctccgacctgcgcgccatcccgtgggtgctggcgtggagccagtcgcgggtcatg
ctgcccggctggtacggcaccgggacggccttcgagcagtggatcgcggcgggcccgcag
acaaaggacgagcgggtgggcatcctgcacgacctgtaccaacggtggccgtttttccgc
agcgtgctgtccaacctggcgcaggtgctggccaaaagcgacctgggcctggcggcgcgc
tatgccgaattggtcgacgacgaggaactacggcgccgggtgttcgacaagatcgccgac
gagcaccgccgcaccatcgccatgcacaagctgatcaccgggcaggacaacctgctcgcc
gacaaccccgccctggcgcggtcggtgttcaaccgcttcccgtatctcgagccgctgaac
cacctccaggtggagttgctgcgccgctaccgctccggcgacgacgacgaattggtgcag
cgcggcattttgctgacgatgaacgggctggccagcgcgctgcgaaacagcggctga

DBGET integrated database retrieval system