KEGG   Mycobacterium marseillense: CKJ54_15175Help
Entry
CKJ54_15175       CDS       T05049                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01130  Biosynthesis of antibiotics
mmal01230  Biosynthesis of amino acids
Module
mmal_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CKJ54_15175
Enzymes [BR:mmal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     CKJ54_15175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin AAA_17 AAA AAA_24 KTI12 AAA_5 AAA_22 AAA_28 AAA_16 6PF2K MMR_HSR1 Mg_chelatase Viral_helicase1 Ploopntkinase3 CoaE RuvB_N
Motif
Other DBs
NCBI-ProteinID: ASW91063
UniProt: A0A1A3JP82
LinkDB All DBs
Position
complement(3330732..3331256)
Genome map
AA seq 174 aa AA seqDB search
MAPKAVLIGLPGSGKSTIGRRLAKALDVDFVDTDAAIEQRTGRRIDEIFATDGEREFRRI
EEEVVRSALADHDGVLSLGGGAVTSPGVREALAGHTVVYLEISATEGVRRTGGNTVRPLL
AGPDRADKYRALMAERSPLYRRAATIRVDTNRRNPGAVVRYIVSRLQAPAGAAR
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccaaagcggtcctcatcgggttgccggggtcgggcaagtccaccatcgggcgc
cggctggccaaggcgctcgatgtcgacttcgtcgacaccgacgcggcgatcgagcagcgg
accggccgccgcatcgacgagatcttcgccaccgacggcgagcgagaattccggcgcatc
gaggaagaggtggtgcgctcggcgctggccgaccacgacggcgtgctttccctgggcggc
ggcgccgtcaccagccccggggtgcgcgaggcgctggccggtcacaccgtcgtctacctg
gagatcagcgccaccgaaggcgtccggcgcacgggcggcaacacggtgcgcccgctgctg
gccgggcccgaccgcgccgacaagtaccgcgcgttgatggccgaacgtagtccgctgtat
cggcgggcggcgaccatccgcgtcgacaccaaccggcgcaacccgggcgcggtggtccgc
tacatcgtctcgcggttgcaggccccggcgggggcggccagatga

DBGET integrated database retrieval system