KEGG   Mycobacterium marseillense: CKJ54_17565Help
Entry
CKJ54_17565       CDS       T05049                                 

Definition
(GenBank) glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00500  Starch and sucrose metabolism
mmal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKJ54_17565
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmal01003]
    CKJ54_17565
Enzymes [BR:mmal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CKJ54_17565
Glycosyltransferases [BR:mmal01003]
 Polysaccharide
  Storage polysaccharide
   CKJ54_17565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_2 Glycogen_syn
Motif
Other DBs
NCBI-ProteinID: ASW93109
UniProt: A0A249BHA2
LinkDB All DBs
Position
3794018..3795262
Genome map
AA seq 414 aa AA seqDB search
MRVLMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDPRSHPSSDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHSMIRAGLNLKEPGSNNPWRPDVVHAHDWLVAH
PAIALAQFYDVPMVSTIHATEAGRHSGWVSGALSRQVHAVESWLVRESDSLITCSGSMAD
EITELFGPGLAEITVICNGIETERWPFAARRPRPGPAELLYLGRLEYEKGVHDVIAALPR
IRRTHPGTTLTIAGEGTQQRWLIEQARKHRVLKAIRFVGHLEHAELLAVLHRADAAVLPS
HYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVTRLAAAIRRVLDDPD
AAQQRARAARERLTSDFDWHTVADKTAQVYLAAKRGERQPQARLPIVEHALPDR
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgagagtcctgatggtgtcgtgggaataccccccggtggtcatcggcgggctgggccgg
cacgtccatcacctgtccaccgcgctggccgccgccggccacgacgtcgtcgtgctgtct
cgccggcccaccggaaccgatccccgcagccacccgtcctccgaccagatcagcgagggg
gtccgggtgatcgcggccgcccaggacccgcacgaattcaccttcggcaccgacatgatg
gcctggacgctcgcgatggggcattccatgatccgcgccgggctgaacctcaaggaaccc
ggcagcaacaacccgtggcgtcccgacgtcgtgcacgcccacgactggctggtggctcat
ccggcgatcgcgttggcccaattctatgacgtgccaatggtttccacgatccacgcgacc
gaggcgggtcgccattccggctgggtcagcggtgcgctcagccgccaggtgcacgcggtc
gaatcctggctggtgcgcgaatccgattcgctgatcacctgttcggggtcgatggccgac
gagatcaccgaactgttcggccccggcctggccgagatcaccgtgatctgcaacggcatc
gagacggagcggtggccgttcgcggcgcgccgaccgcggcctgggccggccgaactgctc
tacctggggcggctggagtacgagaagggggtgcacgacgtcatcgccgcgctcccccgg
atcaggcgcacccacccgggcaccacgctgaccatcgccggcgagggcactcagcagcgc
tggctgatcgagcaagcccgtaaacaccgggtgctcaaggcgattcggttcgtcggtcac
ctcgagcacgcggaattgttggcggtattgcatcgcgccgacgccgcggtgttgcccagc
cactacgagcccttcggcatcgtggcgctggaggcggccgcggccggcactcccctggtg
acgtcgaacatcggtgggctgggcgaggcggtgatcgacggtcagaccggtgtgtcgtgc
ccgccgcgggacgtgacccggctggccgcggcgatccgccgggtgctcgacgatccggac
gccgcgcaacaacgcgcgcgggccgcccgcgaacgcctcacgtccgacttcgattggcat
acggtggccgacaagaccgcgcaggtgtatctggcggccaagcgcggtgagcggcagccg
caggcacggctccccatcgtcgaacacgccttgccggaccggtag

DBGET integrated database retrieval system