KEGG   Mycobacterium marseillense: CKJ54_17715Help
Entry
CKJ54_17715       CDS       T05049                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00071  Fatty acid degradation
mmal00280  Valine, leucine and isoleucine degradation
mmal00281  Geraniol degradation
mmal00310  Lysine degradation
mmal00360  Phenylalanine metabolism
mmal00362  Benzoate degradation
mmal00380  Tryptophan metabolism
mmal00410  beta-Alanine metabolism
mmal00627  Aminobenzoate degradation
mmal00640  Propanoate metabolism
mmal00650  Butanoate metabolism
mmal00903  Limonene and pinene degradation
mmal00930  Caprolactam degradation
mmal01100  Metabolic pathways
mmal01110  Biosynthesis of secondary metabolites
mmal01120  Microbial metabolism in diverse environments
mmal01130  Biosynthesis of antibiotics
mmal01212  Fatty acid metabolism
Module
mmal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CKJ54_17715
   00650 Butanoate metabolism
    CKJ54_17715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CKJ54_17715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CKJ54_17715
   00310 Lysine degradation
    CKJ54_17715
   00360 Phenylalanine metabolism
    CKJ54_17715
   00380 Tryptophan metabolism
    CKJ54_17715
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CKJ54_17715
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CKJ54_17715
   00281 Geraniol degradation
    CKJ54_17715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CKJ54_17715
   00627 Aminobenzoate degradation
    CKJ54_17715
   00930 Caprolactam degradation
    CKJ54_17715
Enzymes [BR:mmal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CKJ54_17715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ASW93112
LinkDB All DBs
Position
complement(3821155..3821919)
Genome map
AA seq 254 aa AA seqDB search
MSEFVSVVVSDGSQDAGLAMLLLSRPPTNAMTRQVYREVITAAEELGRRDDVAVVILFGG
HEIFSAGDDMPELRTLRGAEAETAARVRQEAIDAVAAIPKPTVAAITGYALGAGLTLALA
ADWRISGDNVKFGATEILAGLVPGGDALARLTRAAGASKAKDLVFSGRFFDAEEALALDL
IDEMVAPDDVYDAAAGWARRFLDGPRHALAAAKAGINDVFDLERSERLAAERRRYAEVFS
AGQGGGDRADPGGR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagttcgtcagcgtcgtggtcagcgacggctcgcaggacgccggcctggccatg
ctgctgctgtcgcggcccccgacgaacgcgatgacccgccaggtctaccgcgaggtcatc
acggccgccgaggaactggggcggcgcgacgacgtcgccgtcgtgatcctgttcggcggc
cacgagatcttctccgccggcgacgacatgcccgaactgcgcacgctgcggggcgccgag
gccgagaccgcggcccgggtccggcaggaggccatcgacgcggtcgccgccatccccaag
ccgaccgtggccgcgatcaccggatacgcgctgggcgccgggctcacgctggcgctggcc
gccgactggcgcatcagcggcgacaacgtgaagttcggcgcgaccgagatcctggccggg
ctggtgcccggcggcgacgcgctggcccgcctgacccgggccgccggggcgagcaaggcc
aaggacctggtgttcagcgggcggttcttcgacgccgaagaggccctggcgctggacctc
atcgacgagatggtggcccccgacgacgtgtacgacgccgccgcaggatgggcgcgccgc
ttcctcgatggcccgcggcacgcgctggccgccgccaaggccgggatcaacgacgtgttc
gacctggagcgctccgagcggctcgccgccgagcgccgccgctacgcggaggtgttttct
gctggtcagggcggtggcgatcgagcggatcccggcggccgttag

DBGET integrated database retrieval system