KEGG   Mycobacterium marseillense: CKJ54_18615Help
Entry
CKJ54_18615       CDS       T05049                                 

Gene name
katE
Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mmal  Mycobacterium marseillense
Pathway
mmal00380  Tryptophan metabolism
mmal00630  Glyoxylate and dicarboxylate metabolism
mmal01110  Biosynthesis of secondary metabolites
mmal01130  Biosynthesis of antibiotics
mmal01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmal00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CKJ54_18615 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CKJ54_18615 (katE)
Enzymes [BR:mmal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CKJ54_18615 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ASW91650
UniProt: A0A249BB54
LinkDB All DBs
Position
3993143..3995245
Genome map
AA seq 700 aa AA seqDB search
MATDQNPKQRDLESARFRRDTGYLTTQQGVRVDHTDDSLTVGERGPTLLEDFHAREKITH
FDHERIPERVVHARGAGAYGYFEPYDDSLAQYTAAKFLTTPGLQTPVFVRFSTVAGSRGS
ADTVRDVRGFATKFYTEQGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNEIPQAQSA
HDTLWDFVSLQPETLHTIMWLMSDRALPRSYRMMQGFGVHTFRLVNDRGEGTFVKFHWKP
RLGVHSLIWDECQKIAGKDPDYNRRDLWEAIESGQYPEWELGVQLVPEEDEFNFDFDLLD
ATKIIPEEQVPVRPVGKMVLNRNPDNFFAETEQVAFHTANVVPGIDFTNDPLLQFRNFSY
LDTQLIRLGGPNFAQLPINRPVAEVRTNQHDGYGQHAIPQGRSSYYKNSIGGGCPALADE
NVFRHYTQRVDGQTMRKRAEAFENHYSQARMFWKSMTAVEAEHIVAAFAFELGKVEMPEI
RSAVVAQLARVDGELAAQVAAKLGLPAPPEEQVDTVTASPALSQVIDAGDTIESRKVAVL
AADGVDVVGTQRFIELMGQRGAMVEVLAPVAGGTLEGGSGGELPVDRSFTTMASVLYDAV
VVACGPRSIATLSNDGYAVHFVTEAYKHLKPIGAYGAGVDLLRTAGITNRLAEDTDVLND
QSVITTKAAADELPDRFVEEFADALARHRCWQRRTDPVPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaccagaatcccaagcagcgagacctggagtccgcacggttccgtcgggac
accggatacctgacgacccagcagggcgtgcgcgtcgaccacaccgacgattcgttgacc
gtcggtgagcggggaccgaccctgctggaggacttccacgcccgcgagaagatcacccac
ttcgaccacgagcgcatcccggagcgcgtggtgcacgcgcggggcgccggcgcctacggt
tacttcgagccgtacgacgactcgttggcgcagtacaccgcggcgaaattcttgacgacg
cccggcctgcaaaccccggtgttcgtgcggttctccacggtggccgggtcacgcggctcg
gccgacaccgtgcgcgacgtgcgcggcttcgccaccaagttctacaccgaacaaggcaac
tacgacctggtgggcaacaacttcccggtgttcttcatccaggacggcatcaagttcccc
gacttcgtgcacgcggtgaaacccgagccgcacaacgagattccgcaggcgcagtcggcg
cacgacaccctctgggacttcgtgtcgctgcagcccgagaccctgcacaccatcatgtgg
ctgatgtcggaccgggcgttgccgcgcagctaccgcatgatgcagggcttcggcgtgcac
accttccggctggtaaacgaccgcggcgagggaactttcgtgaagttccactggaagccg
cggctgggcgtgcactcactgatctgggacgaatgccaaaagatcgccggcaaagacccc
gactacaaccgccgcgacctgtgggaggccatcgagtcgggccagtacccggaatgggaa
ctcggcgttcagctcgtgcccgaggaggacgagttcaacttcgatttcgatctgctcgac
gcgacgaaaatcattcccgaagaacaggttccggttcgacccgtgggcaagatggtgctg
aaccgcaacccggacaacttcttcgccgagaccgagcaggtcgcgtttcacacggcgaac
gtggtgcccggcatcgacttcaccaacgatccgctgctgcagttccgcaacttctcctac
ctggacacccagctgatccggttgggcggccccaacttcgcccagctgccgatcaaccgt
ccggtggccgaggtccggaccaaccagcacgatggttacgggcagcacgcgatcccgcag
ggcaggtccagctactacaagaacagcatcggcggcggctgcccagccctggccgacgag
aacgtgttccggcactacacccagcgcgtcgacgggcagaccatgcgcaagcgcgccgag
gcctttgagaatcactacagccaggcgcggatgttctggaagagcatgacggctgtggaa
gccgaacacattgtcgcggcgttcgccttcgaactcggcaaggtggaaatgcccgagatc
cgttcggcggtggtggcgcagctcgcgcgggtcgacggtgagctggccgcccaggtcgcc
gcgaaactggggctgcccgcgccccccgaggaacaggtcgacacggtgaccgcctcgccg
gcgctgtcacaggtcatcgacgcgggcgacaccatcgaatcgcgcaaggtcgcggtgctg
gccgccgacggcgtcgacgtggtggggacacagcgcttcatcgagctgatgggacagcgc
ggcgccatggtcgaggtgctggcgccggtggccggcggcacgctggaaggcggttccggc
ggcgagcttcccgtcgaccgctccttcaccacgatggcgtcagtgctctacgacgcggtt
gtcgtggcgtgcggaccgcgctcgatcgcgacgctgtccaacgacggctacgcggtgcat
ttcgtgaccgaggcctacaagcacctcaagcccatcggcgcttacggcgccggcgtcgat
ctgctgcgcaccgccggtatcaccaaccgcctcgccgaggacaccgacgtgctcaacgac
cagtcggtcatcaccactaaagccgccgccgacgagttgcccgaccgcttcgtcgaggaa
ttcgccgacgcgctcgcgcggcaccggtgctggcagcggcgcaccgacccggttccggcc
tag

DBGET integrated database retrieval system