KEGG   Modestobacter marinus: MODMU_2032Help
Entry
MODMU_2032        CDS       T02167                                 

Gene name
iaaH
Definition
(GenBank) Indoleacetamide hydrolase
  KO
K21801  indoleacetamide hydrolase [EC:3.5.1.-]
Organism
mmar  Modestobacter marinus
Pathway
mmar00380  Tryptophan metabolism
mmar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MODMU_2032 (iaaH)
Enzymes [BR:mmar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     MODMU_2032 (iaaH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase Glu_cys_ligase
Motif
Other DBs
NCBI-ProteinID: CCH87467
UniProt: I4EVQ4
LinkDB All DBs
Position
complement(1986216..1987547)
Genome map
AA seq 443 aa AA seqDB search
MDQVRQRIASSSAAEVVAASTRAARDAADLGAFLSVADAPEPGTGPLAGVPLAVKDNLDT
VDLPTTGGTPALRGSRPGRDQHAVAQLRAAGAAVIGKTNLHELALGITSNNAAFGPVRNP
HDRSRSAGGSSGGSAVAVATGVVPLALGTDTGGSLRVPAAHCGVVGWRPTVGRWGTGRTV
PISRTRDTAGVLATSVADVALVDALVTGEAAPAPPSGRPLRLGVPREGFYDDLHPEVAAC
TERALEQLAAAGVELVEVRVADAHALDAECGFPIVFAELAQDLPAYLATLPGPERGLTLA
DVLAQVASPDVRGALEAAASGTFTAAVHAQALATRERLRAAYAAALRPAGADPLDALVYP
TVPLPAPPLGDDDTTELNGRQVPVFLTTIRNTGPGSTAGMPALSLPAGTTRAGLPVGLSL
EALPGGDVALLATARRVETALGR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggaccaggtacgccagcggatcgcctcctcctcggcggcggaggtggtcgccgcgagc
acccgggcggcccgcgacgccgccgacctcggcgccttcctctcggtcgccgacgcaccg
gagcccggcaccggcccgctcgccggcgtcccgctcgcggtcaaggacaacctggacacc
gtcgacctgcccaccaccggcgggaccccggccctccgcggctcccggccgggccgtgac
cagcacgcggtggcgcagctgcgcgcggccggcgctgcggtgatcggcaagaccaacctg
cacgagctggcgctgggcatcaccagcaacaacgccgccttcggcccggtgcgcaacccg
cacgaccgcagccgctcggccggcggctcctcgggcgggtccgccgtcgccgtcgcgacc
ggggtcgtgcccctggcgctgggcaccgacaccggcgggtcgctgcgggtgccggcagcg
cactgcggggtggtgggctggcgcccgacggtcggccgctggggcaccggccgcacggtg
cccatctcccgcacccgggacaccgccggggtgctcgcgacctcggtggccgacgtggcg
ctcgtcgacgcgctcgtcaccggcgaggccgctccggcgccgccgtcgggccggccgctg
cggctgggggtgccgcgcgaggggttctacgacgacctgcaccccgaggtcgccgcctgc
accgagcgggcgctggagcagctggccgccgccggcgtcgagctggtcgaggtgcgggtc
gcggacgcccacgcgctggacgccgagtgcggcttcccgatcgtcttcgccgagctggcc
caggacctgcccgcctacctggcgacgctgcccggaccggagcgcgggctcaccctggcc
gacgtgctggcccaggtggcctcacccgacgtccgcggcgcgctcgaggccgcggcgagc
gggaccttcaccgcggcggtgcacgcgcaggcgctggccacccgggagcggctgcgcgcc
gcctacgccgccgccctgcggcccgccggggccgacccgctggacgccctcgtgtacccg
acggtgccgctgcccgcgccgccgctgggcgacgacgacacgaccgagctcaacggccgg
caggtgccggtcttcctgaccaccatccgcaacaccggtcccggctcgaccgcggggatg
ccggccctctccctgcccgccgggacgacccgcgccggcctgcccgtcggcctctccctc
gaggccctgccgggcggggacgtcgccctgctggcgaccgcccgccgggtggagaccgcg
ctggggcgctga

DBGET integrated database retrieval system