KEGG   Modestobacter marinus: MODMU_3673Help
Entry
MODMU_3673        CDS       T02167                                 

Gene name
lig
Definition
(GenBank) ATP-dependent DNA ligase
Organism
mmar  Modestobacter marinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: CCH89083
UniProt: I4F0C0
LinkDB All DBs
Position
3671121..3672194
Genome map
AA seq 357 aa AA seqDB search
MDLPVMPPVKPMLAKPAAALPTGEGWFYEPKWDGFRCIVFRDGDEVELGSRNERPLTRYF
PDVAEAVKAQLPERCVVDGEIVVPRGDRLDFESLLQRIHPAASRVTKLATETPASFVAFD
LLAIGDESLLETPYAERQARLREALAGAKAPVYVSTVTQDAEVGQRWFAEFEGAGLDGVI
AKRGDQVYAPDQRLMTKVKHVRTADCVVAGFRWHKSGPVVGSLLLGLYDDAGSLQHIGVA
ASFPMKRRAELVDELTPYRAEALDGHPWQDWANAQTDADGEHRMPGATSRWNAGKDLSWV
PLRPELVVEIRYDQLEGSRLRHTGQFQRWRPDREARSCTYDQLEVPVKYDLAEVLGG
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgatgcccccggtcaagccgatgctcgccaagcccgcggcggcgctg
cccaccggggagggctggttctacgagccgaagtgggacggcttccgctgcatcgtcttc
cgggacggcgacgaggtcgagctgggcagccgcaacgagcgcccgctgacccgctacttc
cccgacgtcgccgaggcggtcaaggcccagctgccggagcggtgcgtcgtcgacggggaa
attgtcgtcccccggggtgaccggctggacttcgagtcgctgctgcagcgcatccacccg
gccgcctcgcgggtgaccaagctggccaccgagaccccggcgtccttcgtcgccttcgac
ctgctggccatcggcgacgagtcgctgctggagaccccctacgccgagcggcaggcccgg
ctgcgcgaggcgctggccggcgcgaaggccccggtgtacgtcagcaccgtcacccaggac
gccgaggtcgggcagcgctggttcgccgagttcgagggcgccgggctcgacggcgtcatc
gccaagcgcggcgaccaggtctacgcccccgaccagcggctgatgaccaaggtcaagcac
gtgcggacggcggactgcgtcgtcgccgggttccgctggcacaagagcggaccggtcgtc
ggctcgctgctgctcgggctctacgacgacgccgggagcctgcagcacatcggcgtcgcc
gcctccttcccgatgaagcgccgggccgagctggtcgacgagctcaccccctaccgggcc
gaggcgctcgacgggcacccgtggcaggactgggccaacgcgcagaccgacgccgacggc
gagcaccggatgcccggcgccaccagccgctggaacgccggcaaggacctgtcctgggtg
ccgctgcgccccgagctcgtcgtggagatccggtacgaccagctcgagggcagccggttg
cggcacaccgggcagttccagcgctggcggcccgaccgggaggcccggtcgtgcacctac
gaccagctcgaggtgccggtgaagtacgacctcgccgaggtgctgggcggctga

DBGET integrated database retrieval system