KEGG   Modestobacter marinus: MODMU_3676Help
Entry
MODMU_3676        CDS       T02167                                 

Definition
(GenBank) putative DNA polymerase LigD
Organism
mmar  Modestobacter marinus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CCH89086
UniProt: I4F0C3
LinkDB All DBs
Position
3674985..3676052
Genome map
AA seq 355 aa AA seqDB search
MASSKDAVVLDVAGHEVRVSSPEKPYFGDKGIRKIDVVNYFVSVGEGILFALRDRPTTLE
RWPGGVFEGARLSTRMDNTGDAFYQKRVPKNAPEWVPTAHITFPSGRTADEIAPDSVAVV
AWCANLGTLTFHPWPVSKTDVESPDQIRIDLDPQPGTDFSDAVWVAPHVRELLHEFGMEG
WPKTSGGRGVHVYVPIQPRWTFPEVRRAVIAFGRELERRIPDRVTMNWWKEERGEKIFID
YNQMARDRTIASAYSIRAKSHAPVSAPLDWDELGDVSPFDFDVLTMPARFAAVGDKHAGL
ADHAFGIEPLIELADKQERDLGLGEMPYPPDYPKMPGEPMRVQPSRAKRPTSTDD
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggccagcagcaaggacgccgtcgtcctggacgtcgccgggcacgaggtgcgggtcagc
agcccggagaagccgtacttcggtgacaagggcatccggaagatcgacgtcgtcaactac
ttcgtctcggtcggcgagggcatcctgttcgcgctgcgcgaccggccgacgacgctggag
cgctggcccgggggcgtgttcgagggcgcgcggctctccacccggatggacaacaccggc
gacgcgttctaccagaagcgggtgcccaagaacgcgcccgagtgggtgccgaccgcgcac
atcaccttccccagcgggcggaccgccgacgagatcgcgccggactcggtcgccgtcgtc
gcctggtgcgccaacctgggcacgctgaccttccacccgtggccggtgtcgaagaccgac
gtggagtcccccgaccagatccgcatcgacctcgacccgcagccgggcaccgacttctcc
gacgccgtgtgggtggccccgcacgtgcgcgagctgctgcacgagttcggcatggagggc
tggccgaagacctccggcggccgcggggtgcacgtgtacgtgccgatccagccgcggtgg
accttccccgaggtgcgccgggcggtgatcgccttcggccgcgagctggagcggcgcatc
cccgaccgcgtgacgatgaactggtggaaggaggagcgcggcgagaagatcttcatcgac
tacaaccagatggccagagaccggacgatcgcgtcggcctactcgatccgggcgaagtcg
cacgcgccggtgagcgccccgctggactgggacgagctgggtgacgtctcgccgttcgac
ttcgacgtcctcaccatgccggcccggttcgccgccgtcggtgacaagcacgccgggctg
gccgaccacgcgttcggcatcgagccgctcatcgagctggccgacaagcaggagcgcgac
ctggggctgggcgagatgccctatcccccggactacccgaagatgcccggcgaaccaatg
cgggtgcagcccagccgcgccaagcgtcctaccagcacggatgactga

DBGET integrated database retrieval system