KEGG   Modestobacter marinus: MODMU_4573Help
Entry
MODMU_4573        CDS       T02167                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
mmar  Modestobacter marinus
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MODMU_4573 (sodN)
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MODMU_4573 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: CCH89956
UniProt: I4F2U3
LinkDB All DBs
Position
4571886..4572290
Genome map
AA seq 134 aa AA seqDB search
MRLFRMFSAVEATAHCDLPCGVYDPAQARIEAESVKAIQEKCQGNEDPVFRTRAILIKEQ
RADLVKHHLWVLWTDYFKPPHFEKYPQLHELFNKATKQAGAAGGKGSMDPAEGQKLLDYI
AEIDKIFWETKAAA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctgttccgcatgttctccgccgtggaggccaccgcgcactgcgacctcccctgc
ggcgtgtacgacccggcccaggcccggatcgaggccgagagcgtcaaggccatccaggag
aagtgccagggcaacgaggacccggtcttccgcacccgcgccatcctgatcaaggagcag
cgggcggacctggtcaagcaccacctgtgggtcctgtggaccgactacttcaagcccccg
cacttcgagaagtacccgcagctgcacgagctgttcaacaaggccaccaagcaggccggc
gccgccggcggcaagggcagcatggacccggccgaggggcagaagctcctcgactacatc
gcggagatcgacaagatcttctgggagaccaaggccgcagcctga

DBGET integrated database retrieval system