KEGG   Modestobacter marinus: MODMU_4824Help
Entry
MODMU_4824        CDS       T02167                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP] (Oxalosuccinate decarboxylase) (IDH) (NADP(+)-specific ICDH) (IDP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmar  Modestobacter marinus
Pathway
mmar00020  Citrate cycle (TCA cycle)
mmar00480  Glutathione metabolism
mmar01100  Metabolic pathways
mmar01110  Biosynthesis of secondary metabolites
mmar01120  Microbial metabolism in diverse environments
mmar01130  Biosynthesis of antibiotics
mmar01200  Carbon metabolism
mmar01210  2-Oxocarboxylic acid metabolism
mmar01230  Biosynthesis of amino acids
Module
mmar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmar_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MODMU_4824 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MODMU_4824 (icd)
Enzymes [BR:mmar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MODMU_4824 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CCH90205
UniProt: I4F3J2
LinkDB All DBs
Position
complement(4830455..4831669)
Genome map
AA seq 404 aa AA seqDB search
MSKIKVEGKVVELDGDEMTRIIWQFIKDQLILPYLDVDLEYYDLGMENRDATDDQVTIDA
ANAIKQHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGVIFREPIIMQNVPRL
VPGWTKPIIIGRHAYGDQYRATDFTFPTAGTLKVVFTPEDGGEPIEREVFQAPGAGVSLS
MYNLDESIYDFARASLNYGLNRGYPVYLSTKNTILKAYDGRFKDIFEEVYQTEFKEQFDA
AGITYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLATPDGK
VVEAEAAHGTVTRHYRQHQQGKETSTNPIASIFAWTRGLAHRGVLDGTPEVTRFAETLER
VCVETVESGQMTKDLALLISKDAPWLTTQDFLAAIDANLQKAMA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagatcaaggtcgagggcaaggtcgtcgagctcgacggcgacgagatgacccgg
atcatctggcagttcatcaaggaccagctgatcctcccgtacctcgacgtcgacctcgag
tactacgacctcggcatggagaaccgcgacgcgaccgacgaccaggtcacgatcgacgcg
gccaacgccatcaagcagcacggtgtgggcgtcaagtgcgccaccatcacccccgacgag
gcgcgggtcgaggagttcggcctgaagaagatgtggcgctccccgaacgggacgatccgc
aacatcctcggcggcgtcatcttccgcgagccgatcatcatgcagaacgtgccgcggctc
gtaccgggctggaccaagccgatcatcatcggccggcacgcctacggcgaccagtaccgc
gccaccgacttcaccttcccgaccgccggcacgctgaaggtcgtcttcacccccgaggac
ggcggcgagcccatcgagcgcgaggtcttccaggcgccgggcgccggtgtctcgctgtcg
atgtacaacctcgacgagtcgatctacgacttcgcgcgggcctcgctgaactacgggctc
aaccgcggctacccggtgtacctgtccacgaagaacacgatcctcaaggcctacgacggc
cggttcaaggacatcttcgaggaggtctaccagaccgagttcaaggagcagttcgacgcc
gccggcatcacctacgagcaccggctgatcgacgacatggtcgccgcctcgctgaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggtgacgtgcagtccgacaccgtg
gcgcagggcttcggctcgctcggcctgatgacctcggtcctggccaccccggacggcaag
gtcgtcgaggccgaggccgcccacggcacggtgacccggcactaccgccagcaccagcag
ggcaaggagacctcgaccaacccgatcgcgtcgatcttcgcctggacccggggcctggcc
caccgcggcgtgctcgacggcacccccgaggtgacccgcttcgcggagaccctcgagcgc
gtctgcgtcgagaccgtcgagagcggtcagatgaccaaggacctcgccctgctgatcagc
aaggacgccccctggctgaccacccaggacttcctggcggccatcgacgccaacctgcag
aaggccatggcctga

DBGET integrated database retrieval system