KEGG   Myxococcus macrosporus: MYMAC_002528Help
Entry
MYMAC_002528      CDS       T05096                                 

Definition
(GenBank) peptidase M50
  KO
K11749  regulator of sigma E protease [EC:3.4.24.-]
Organism
mmas  Myxococcus macrosporus
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmas01002]
    MYMAC_002528
Enzymes [BR:mmas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     MYMAC_002528
Peptidases and inhibitors [BR:mmas01002]
 Metallo peptidases
  Family M50: S2P protease family
   MYMAC_002528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M50 PDZ_6 PDZ_2 PDZ
Motif
Other DBs
NCBI-ProteinID: ATB46923
UniProt: A0A250JT94
LinkDB All DBs
Position
complement(2984857..2986047)
Genome map
AA seq 396 aa AA seqDB search
MHYALVLLALGGLLTFHELGHLVAARLLGVRVPRFVFGFGPPLVSFRLWGTQYVVAAVPL
GATAHLQGMNPHRADTEEAAGFASRGPLLRILIILAGPLANYALALGVLFALYTSGTHVV
VPLTVGTVQPGSEAARAQLLPGDRIVQVSGQPPRSWSEFVEKVGAAPGAPLELEVERGGE
RRAVVVRPRPDERGTGRIGVSQQYVYKAHGAGEALSHSFTHTVNVASEGVALLKRMLDDL
ESPDAASPGALVRQESADAMASGTDALLRTLVAASVVLALLTLLPVPGLDGGRVLLLLVE
AASGRRVPPRVETVAQTVGFLGIAVAVVMMATAEIRRALPARLGMEEAPAPDAGVAQPPR
TTTGAAPTGSPQAPSSAEAPPSTSNTSPAGAVAPSP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcattacgcgctcgtcctgctcgccctgggcggcctgctgaccttccacgagctgggg
cacctcgtcgccgcgcggctgctcggcgtgcgggtgccccgcttcgtgttcgggttcggc
ccgccgctggtgtccttccgcctgtgggggacgcagtacgtggtggcggcggtgcccctg
ggcgccacggcgcacctgcaggggatgaacccgcaccgcgcggacacggaggaggccgcg
ggcttcgcctcgcgcgggccgctgctgcgcatcctcatcatcctggcggggccgctggcc
aactacgcgctcgcgttgggcgtgctgttcgcgctgtacacgtcgggcacgcacgtggtg
gtgccgctgacggtggggacggtgcagccgggctccgaggcggcgcgcgcgcaactgctg
cccggggaccgcatcgtccaggtctccggacagccgccgcggagctggtcggagttcgtg
gagaaggtgggcgcggcgccgggcgctcccctggagctggaggtggagcgtggcggagag
cggcgcgccgtggtggtccggccccggccggatgagcgcggcacgggccgcatcggggtg
agccagcagtacgtctacaaggcgcatggcgcgggtgaggcgctgagccattcgttcacg
cacaccgtgaacgtggcctcggagggcgtggcgctgctgaagcggatgctggacgacctg
gagagcccggacgcggcgagtcccggcgcgctggtgcggcaggagtccgcggacgcgatg
gcgtcagggacggacgccctgctgcggacgctggtggccgcgtccgtggtgctggcgctg
ttgacgctgctgcccgtgcccggcctggacggaggccgcgtgctgctgctgcttgtcgag
gcggcgagcggccggcgcgtcccacctcgcgtggagacggtggcgcagacggtggggttc
ctgggcatcgccgtggcggtggtcatgatggcgaccgcggagattcgccgtgcgctgccg
gcgcggctgggcatggaggaagcgccggccccggatgcgggggtggcacagcctccgcgg
accacgaccggcgcggcgcccacgggttcgccccaggcgccttccagcgccgaggctccg
ccgtccacctcgaacacctcgcccgcgggtgccgtggcgccttcgccctga

DBGET integrated database retrieval system