KEGG   Myxococcus macrosporus: MYMAC_002662Help
Entry
MYMAC_002662      CDS       T05096                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00071  Fatty acid degradation
mmas00280  Valine, leucine and isoleucine degradation
mmas00281  Geraniol degradation
mmas00310  Lysine degradation
mmas00360  Phenylalanine metabolism
mmas00362  Benzoate degradation
mmas00380  Tryptophan metabolism
mmas00410  beta-Alanine metabolism
mmas00627  Aminobenzoate degradation
mmas00640  Propanoate metabolism
mmas00650  Butanoate metabolism
mmas00903  Limonene and pinene degradation
mmas00930  Caprolactam degradation
mmas01100  Metabolic pathways
mmas01110  Biosynthesis of secondary metabolites
mmas01120  Microbial metabolism in diverse environments
mmas01130  Biosynthesis of antibiotics
mmas01212  Fatty acid metabolism
Module
mmas_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MYMAC_002662
   00650 Butanoate metabolism
    MYMAC_002662
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MYMAC_002662
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYMAC_002662
   00310 Lysine degradation
    MYMAC_002662
   00360 Phenylalanine metabolism
    MYMAC_002662
   00380 Tryptophan metabolism
    MYMAC_002662
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYMAC_002662
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYMAC_002662
   00281 Geraniol degradation
    MYMAC_002662
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYMAC_002662
   00627 Aminobenzoate degradation
    MYMAC_002662
   00930 Caprolactam degradation
    MYMAC_002662
Enzymes [BR:mmas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYMAC_002662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: ATB47055
UniProt: A0A250JT95
LinkDB All DBs
Position
3148908..3149990
Genome map
AA seq 360 aa AA seqDB search
MTDDLLLETRGAVGVVTLNRPKALNALNLAMCRKLHPALDAWAADPAIQAVVIRGAGGRA
FCAGGDVRAVALSVEGASRDEKERVSREFFRAEYALNHRIHHFGKPFIALVDGVCMGGGL
GLSIHGTHRVVTEKLVLAMPETAIGLFPDVGGGWFLPRFPGESGTYLGLTGARCGAADAM
WLGYATHHVESARLESVLDALVGAPWGTSAASTVVDTVLAGFHADAGTSPLGVQHAAIDR
CFAAERVDDIQQALEVEGTPWAQETWAALLRMCPASLKVTLRQLRMGRTRDYDEMANVEY
RLSQTMTARPDFREGIRAVLVDKDNKPHWQPGTLAEVSDDAVDALFAPLRDDSWTLPARG
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgacctcctgctcgagacgcgtggcgcggtgggcgtggtgaccctgaaccgg
cccaaggcgctgaacgcgctgaacctggcgatgtgccgcaagctgcacccggcgctcgac
gcgtgggccgcggacccggccatccaggccgtcgtcatccggggcgcgggcggccgggcc
ttctgcgcgggcggagacgtgcgcgccgtggcgctgtccgtggagggcgcctcgcgcgac
gagaaggagcgggtgtcccgcgagttcttccgcgccgagtacgcgctgaaccaccgcatc
caccacttcggcaagccgttcatcgcgctggtggacggcgtctgcatgggcggcgggctc
ggcctgtcgattcatgggacgcaccgggtcgtcacggagaagctggtgctggccatgccg
gagacggcgattggtctcttcccggatgtaggcggcggctggttcctgccgcgcttcccc
ggcgagtcgggcacgtacctgggcctcacgggtgcgcggtgcggcgcggcggatgcgatg
tggctgggctacgccacgcaccacgtggagtccgcgcggctggagtcggtgctggacgcg
ctggtgggcgcgccgtggggcaccagcgccgcgagcacggtggtggatacggtgctggcg
ggcttccatgcggacgcggggacgtcgccgctgggcgtgcagcacgccgccatcgaccgg
tgcttcgcagccgagcgcgtggatgacatccagcaggcgctggaagtggagggcacgccc
tgggcacaggagacgtgggcagcgctgctccgcatgtgcccggccagcctgaaggtgacg
ctgcgccagctccggatggggcgcacgcgcgactacgacgagatggcgaacgtggagtac
cggctcagccagacgatgacggcgcggccggacttccgcgagggcatccgcgcggtgctg
gtggacaaggacaacaagccgcactggcagcccggcacgctggcggaggtcagcgatgac
gccgtggacgcgctcttcgcgccgctgcgcgacgattcatggacgctgccggcgcgcggg
tag

DBGET integrated database retrieval system