KEGG   Myxococcus macrosporus: MYMAC_003479Help
Entry
MYMAC_003479      CDS       T05096                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00020  Citrate cycle (TCA cycle)
mmas00480  Glutathione metabolism
mmas01100  Metabolic pathways
mmas01110  Biosynthesis of secondary metabolites
mmas01120  Microbial metabolism in diverse environments
mmas01130  Biosynthesis of antibiotics
mmas01200  Carbon metabolism
mmas01210  2-Oxocarboxylic acid metabolism
mmas01230  Biosynthesis of amino acids
Module
mmas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmas_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYMAC_003479
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYMAC_003479
Enzymes [BR:mmas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MYMAC_003479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ATB47860
UniProt: A0A250JW48
LinkDB All DBs
Position
4159661..4160959
Genome map
AA seq 432 aa AA seqDB search
MAPPSSGEKISLQSGKLSVPDHPIIPYIEGDGTGRDIWRASQAVFDAAVEKAYNGKKKIA
WYEVLAGEKSFKAVNNWLPDETVEAFRTYLVGIKGPLTTPVGGGIRSLNVALRQMLDLYV
CLRPVRYFKGVPSPVKTPEKVDMTIFRENTEDIYAGIEFEAGSPAAEKFLGLLKQEFPKE
FGKIRFPANVGLGVKPVSQEGSGRLIRAAIQYAVDHKRKSVTLVHKGNIMKFTEGAFRKW
GYELAAREFGDKVYTWDQWEATKAAKGEDAANAEQKAALAAGKILIKDSIADITLQQVLT
RPDEFDVIATLNLNGDYLSDALAAQVGGIGIAPGGNINYVTGHAVFEATHGTAPKYADQD
KVNPGSVILSGEMMFRHLGWHEAADLMIKGMDRAIASKTVTYDFARLMKQEGQSGVSEVK
CSEFGQAIIKNM
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccccgtcatccggagagaagatctccctgcagagcggcaagctgtcggttccg
gaccacccgatcatcccctacatcgagggtgatggcaccggccgtgacatctggcgcgcg
tcccaggcggtgttcgacgccgcggtggagaaggcctacaacggcaagaagaagatcgcc
tggtacgaggtgctcgccggcgagaagtccttcaaggcggtcaacaactggctgcccgac
gagacggtcgaggccttccgcacctacctggtcggcatcaagggccccctgacgacgccg
gtgggcggcggcatccggtcgctgaacgtggccctgcggcagatgctggacctgtacgtc
tgcctgcggcccgtgcgctacttcaagggcgtgcccagccccgtgaagacgccggagaag
gtcgacatgaccatcttccgcgagaacacggaggacatctacgccggcatcgagttcgag
gcgggctcccccgccgcggagaagttcctgggcctgctgaagcaggagttcccgaaggag
ttcgggaagatccgcttccccgccaacgtgggcctgggcgtcaagccggtgtcgcaggag
ggcagcggccggttgatccgcgccgccatccagtacgccgtggaccacaagcgcaagagc
gtcacgctggtccacaagggcaacatcatgaagttcaccgagggcgccttccgcaagtgg
ggctacgagctggcggcccgggagttcggtgacaaggtctacacctgggaccagtgggag
gccaccaaggccgccaagggcgaggacgccgccaacgcggagcagaaggccgcgctggcc
gccgggaagatcctgatcaaggactccatcgcggacatcaccctgcagcaggtcctcacc
cgtccggacgagttcgacgtcatcgccacgctgaacctcaacggcgactacctgtcggac
gcgctggcggcgcaggtgggcggcatcggcatcgcgccgggcggcaacatcaactacgtc
acgggccacgcggtgttcgaggccacgcacggcacggcgcccaagtacgcggaccaggac
aaggtgaacccgggctcggtcatcctctccggtgagatgatgttccggcacctgggctgg
cacgaggcggccgacctgatgatcaagggcatggaccgcgccatcgccagcaagacggtg
acctacgacttcgcccgcctgatgaagcaggaggggcagagcggggtgtccgaggtcaag
tgctccgagttcgggcaggccatcatcaagaacatgtag

DBGET integrated database retrieval system