KEGG   Myxococcus macrosporus: MYMAC_003522Help
Entry
MYMAC_003522      CDS       T05096                                 

Definition
(GenBank) peptidyl-dipeptidase A
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mmas  Myxococcus macrosporus
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmas01002]
    MYMAC_003522
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmas04147]
    MYMAC_003522
   04090 CD molecules [BR:mmas04090]
    MYMAC_003522
Enzymes [BR:mmas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     MYMAC_003522
Peptidases [BR:mmas01002]
 Metallo Peptidases
  Family M2
   MYMAC_003522
Exosome [BR:mmas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYMAC_003522
CD molecules [BR:mmas04090]
 Proteins
  MYMAC_003522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATB47901
UniProt: A0A250JX28
LinkDB All DBs
Position
4214996..4216882
Genome map
AA seq 628 aa AA seqDB search
MNRKRPLNSLLRAAAAMALPAFLGCAQDSQVTREAPAPAESSTPTAPTASQPTPEEAKAF
AEKVNADLKRLWTKQATAEWIKSTYITDDTEQNAAFVNEEVLAYVNGAIKEARRFDGLTL
DADTARMLHLLKVSQALPAPSDAQKRAELAATAAKLEGLYGKGKYCGPDGKGKCRDLEVL
SDVIAESRDYDELLDAWQGWHSVARPMRPLYERLVSISNEGAKDIGFNDLGTLWRSAYDM
SPAEFEVEAQRLWGQVKPLYDDVHCYVRGRLAKQYGADKVPEGKPIPAHLLGNMWAQEWN
NIYPLVEPFPGQANLDVDAALKQQKYDAMRMVKLGEKFFTSLGLKPLPRTFFERSQFTKP
EGRDVVCHASAWDVNYSNDLRIKMCIKPTEEDLVTIHHELGHNYYYTYYYQLPVLFQAGA
NDGFHEAIGDALTLSITPGYLQQAGLLKSVPKNEKNLINLQMKDALEKIAFLPFGLLVDQ
WRWEVFSGRVQPADYNKSWWALREKYQGVAAPVARSEQDFDPGAKYHVPANVPYTRYFLA
RILQFQFHKALCEASGHTGPLHECSIYGNKEAGKRLQAMLELGASKPWPDALQAMTGTRQ
MDATPLLDYFSPLRTWLQAQNKGQKCGW
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaacgtcccctgaactccctgctgcgtgcggccgcggccatggcgctgccc
gccttcctggggtgtgcccaggattcgcaagtgacgcgtgaggcgcctgcccccgccgag
tcctccacccccaccgcccccaccgcgtcgcagcccacgccggaagaggcgaaggccttc
gcggagaaggtcaacgcggacctgaagcgcctgtggacgaagcaggccaccgcggagtgg
atcaagtccacgtacatcaccgacgacaccgagcagaacgccgccttcgtcaacgaagag
gtgctggcctacgtcaacggcgccatcaaggaagcgcgccgcttcgacggcctgacgctg
gacgcggacaccgcgcgcatgctgcacctgctcaaggtgtcccaggcgctgccggcgccg
tcggacgcgcagaagcgggccgagctggccgccacggcggcgaagctggaaggcctctac
ggcaagggcaagtactgcgggccggacgggaaggggaagtgccgcgacctggaggtgctg
tccgacgtcatcgcggagagccgcgactacgacgagctgctggacgcgtggcagggctgg
cactccgtggcccgccccatgcggccgctgtacgagcgcctggtgtccatctccaacgag
ggcgccaaggacatcggcttcaacgacctgggcacgctctggcgctccgcgtacgacatg
tccccggccgagttcgaggtcgaggcccagcgcctgtggggccaggtgaagccgctctac
gacgacgtgcactgctacgtgcgcggccggctggcgaagcagtacggcgccgacaaggtg
cctgaaggcaagcccatccccgcgcacctgctgggcaacatgtgggcgcaggagtggaac
aacatctacccgctggtggagcccttccccgggcaggccaacctggacgtggacgcggcg
ctgaagcagcagaagtatgacgcgatgcgcatggtgaagctgggtgagaagttcttcacc
tcgctgggcctcaagccgctgcctcggaccttcttcgagcgctcgcagttcaccaagccg
gaaggccgcgacgtcgtctgccacgccagcgcctgggacgtgaactacagcaacgatttg
cgcatcaagatgtgcatcaagcccacggaggaggacctcgtcaccatccaccacgagctg
ggccacaactactactacacgtactactaccagctcccggtgctcttccaggccggcgcg
aacgacggcttccacgaggccattggtgacgcgctgacgctgtccatcacccccggctac
ctccagcaggcggggctgttgaagtccgttcccaagaacgagaagaacctcatcaacctc
cagatgaaggacgccctggagaagatcgccttcctgcccttcggtctgctcgtggaccag
tggcgttgggaggtgttctccggccgcgtgcagccggcggactacaacaagtcctggtgg
gcgctgcgggagaagtaccagggcgtggccgcgccggtggcccgctccgagcaggacttc
gacccgggggcgaagtaccacgtacccgcaaacgttccgtatacgcgttatttcctggcg
cgaatcctccagttccagttccacaaggcgctctgcgaggcgtccggccacacgggccct
ctccacgagtgctccatctacgggaacaaggaggccggcaagcggctccaggccatgctg
gagctgggcgccagcaagccctggcccgacgcgctccaggccatgacgggcacccggcag
atggacgccacgccgctgcttgactacttcagcccgctgcgcacctggctccaggctcag
aacaagggccagaagtgtggttggtaa

DBGET integrated database retrieval system