KEGG   Myxococcus macrosporus: MYMAC_003564Help
Entry
MYMAC_003564      CDS       T05096                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C Bac_luciferase
Motif
Other DBs
NCBI-ProteinID: ATB47941
UniProt: A0A250JX69
LinkDB All DBs
Position
4294500..4311644
Genome map
AA seq 5714 aa AA seqDB search
MHSPLAVTLLELLETRTRSHGAQPLYTFLEDGGDDAVLSYAGLDVRARRIGAALQALSRA
GERAVLLYPPGLEYIAGFFGCLYAGLIAVPAYPPDPMRLDRTLPRLRAIIRDARASVVLT
TSFIQEMGEGLFEGAPELAALRWVATDALAEGMEDGWRRPAPTGDTLAFLQYTSGSTGDP
KGVRLSHGNLLHNLGLISHAFQVRSDSVGVIWLPPYHDMGLIGGILQPLYAGFPVALMSP
LAFLRRPRFWLEALSRFGGSISGGPCFAFDLCVRKVPPAEREGLDLRRWELAFCGAEPIR
PEVMARFSEAFAPVGFQREALYPCYGLAEGTLIASGGRKGEGILTRTWDAQALERNEALA
VEGGPNARPLVGSGQTLPDQALLVVDPQTRLPCPPERVGEIWVSGPSVAQGYWERPQESE
AAFGARLADADSGPRFLRTGDLGLMKDGELFVVGRRKDLIILRGRNLHPQDLELTLERSH
PALRPGCGAAFAIDVGGEERLAVVYEVDSRKPWTPEDVVSAVRRGLSETHEVQLHTLVLI
EPGALPKTSSGKIQRRACRAELLAGTLRAQLTWSEADAEAPRAEPGAPAVVASEPRTVEE
LEAWLVARIAARLRVRPEDLTKDAAITSFGLDSLGAVELANDIESLGVVLRMEVLLQGPT
VAELARTVFAARGKPSGAELTRGEATAPAPLSSAQQRLWLFAQLAPGSAAYHLPAAVRLT
GALDVAALERAFAAILQRHEALRATFREEDGTPWQVSAPAAVSALRTVDLRDVSPELREA
TALRLAQEAARAPFELAHGPLLRATLLQLAPQEHLLVVVMHHLASDGASFAILARELSAL
YAGVASLPPLALQYPDFARWRREVEAEGAMATATDWWKAHLAGLPAALELPADRPRPPMP
SYCGGRVAVRLPEALTVRLEALGRSEGATLFMTLLAALEVLLARHSGQADFCVGTAVNGR
ERSGLEGMIGCFLDLVVLRASVDGASRFRELLGAAREGVLAAFAHRGVPFERLVEAIQPT
RDPSRAPLFQVLFVLQPEPGAGLALPGLEARRVEVDPGATPYDLTLSLARSAEGLGGWLE
YASDLFDADTAARLVARLEVLLEAVVADPEQRVGALPLLPEAERRQVLTGWNATRTDFPE
TCVHALIEAQARRTPDTVAVVCGDEALTYRELDQRANAVAWRLREQGVGPERVVGLFADR
SVDLAVGLLGILKAGGAYLPLDPSYPEARLALMLEDSGAAVVLAHRHLAGALPAGRRTVV
TLDVRALADGPPPIAVAPGNLAYVLYTSGSTGRPKGVLIPHRNVANFFTGMDARVGAAPG
TWLAVTSVSFDISVLELLWTLARGFKVVVQGEQGALGAAPRRGGRTRRAPLGFSLFYFAA
DEGAPGAERYRLLLEGARFADRHGFQAVWTPERHLHAFGGLYPNPSVTSAAIAAITERVA
IRAGSVVLPLHHPVRVAEEWALVDNLSKGRVGISVAPGWHANDFVLAPERYEDRRELARG
ALDTVRRLWRGEALRFANGAGASTEVRLRPSPVQRELPVWLTAAGNPDTFREAGRLGAGV
LTHLLGQRWEELEARIALYREAWREAGHEGEGHVTLMLHTFVGQDVERVRETVEGPLRRY
LSDSADLMRGLGRTLGVDLDPASVRPEDLDALVGRAFGRFFEGAGLFGTPRTCRDQVARI
EALGVDEVACLIDFGVDTDEVLASLPALDAVRQRCERDFRLQSQGDDAVPAQLRRHGVTH
LQCTPSLAQALLLEPGAPGALAGLERLLVGGEALSEALAARLRGTVGGALLNMYGPTETT
IWSASHAVREAAGPVPIGTPIANTSLYVLDAALRPVPVGVPGELYIGGAGVARGYHARPE
LTAERFLPDPVASEAGARMYRTGDRARWRADGAVEFLGRVDHQLKVRGFRVEPGEVEAVL
ARHPAVARAVVVAREDLPGSARLVAYLVPRLEASLSGDALLAYARRALPEHMVPSAWVTL
EALPLTPNGKVDRKALPAPEGVRDVGREYVAPRTETERRLAELWASLLGVPRVGAEDDFF
ALGGHSLLATRAASRIREAFGVDLPLRELFESASPAALGARLDARRLRASGVPALLARSH
EGALPLSFAQQRLWFLEQLEPGGAAYNDAVAVRVEGALDVPLLERCLREVVLRHDVLRAT
FHEEDGAASWRAHAEPRLALTRVDLTAGEAAARAEALSRRLEAESLRAFDLGAGPPLRVM
LAQVGAREHVLLLVLHHLVTDGASMGVLVREVAALYRAFARGEPSPLPALPLQYVDYAAW
QRDWLRGEALEAQLAYWRARLEGAPRALELPTDRPRPAVRGSRGVSREVCLGAELTRGLK
SLARREGATPFMVLLAGFSALLSRHAGQDDLCVGTPVAGRDRTELEGLIGCFVNTLVLRV
SLAGAPSFLELIGRARETVLGAFAHQDAPFEELVKALQPERDLGRSPLFQAMLVMQEDPL
PELTVPGLRLSVQPQPSHTAKFDLRLILTDTPEGFSANLELSADLFEPDTASRLLEHLRV
LLEAGVRSPEQRVSDLPLMSPAERHQVLVAWNDTLRPRPEAAVLHRLIEAQVDRTPDAVA
VSFEGDALTYRELDLRANQLARFLRARGVGPDTRVAQCTERSLEMVVGLLGVLKAGGAYV
PLEPEYPRERLAFMLADAAAPVLLTQARLAAGLPHGGAAVVCLDSEWGVISREPDTRLDV
AVEGSGLAYVIYTSGSTGRPKGVMNTHAAICNRLRWMQEAYGLDASDRVLQKTPFSFDVS
VWEFFWPLLTGARLVMARPGGHREPAYLTETIARERITTLHFVPSMLRPFLEEPGLEASC
ASLRRVFCSGEALPAELRDRCFSRLGAALHNLYGPTEAAVDVTAWSCEREDRRPVVPIGR
PIANTRLYVLDALLRPVPVGVPGELYIGGVALARGYWRRAALTAERFLPDAFAATPGARM
YRTGDQARFLADGAIEYLGRLDDQVKVRGFRIEPGEIEAALARHPDVRAAAVVVREDVPG
DRRLVAYVAGAPADGGAALRAFLGERLPEHMVPSAFVSMEALPLSPSGKLDRRALPAPPR
AVPGEGAGFVAPRNEQERQLARIWAGVLGVERVGVEDRFFELGGDSILALQVIARARQVG
LHLTARQLFQHPTVAALAQVAGGVRRAGEQGPVVGPVPLTPIQRWFVERELPEPHHFNQA
LMLEPREPLAPEVLARALAALVDHHDALRLRLSRADTGWAQSCDEPGREVPLRRVDLTGL
EVPEQAEAMARVAAEVQAGLDLASGCLLSAVLFERGRARAGRLLLVIHHLAVDGVSWRVL
LEDLETALRQLARGEPVALPAKTTSFQEWARRLEVHAASASVAGERAFWRETTSAEVSPL
PRDFADGVNTQGSERVVTVALAADVTRSLLRSTGAAPEEVLLAGVACTLSRWTGQRRLRI
DLEAHGREELFEDVDLSRTVGWFTSLFPVRLEVSEEPASALASVRASREHRKGRGLGYGL
LRYLRREDDVPAAVGAGASSEVLFNYLGQLDSGARESALFALAAEPTGPSQGTRGLRSHA
LEVVARVVGGRLELAWHYSEALHARERIEALARECREVLAELAGATEQRSPLSPLQHGLL
FQVLLEPGTEAYFEQRSWALSGPLDPEALRRAWEAVSERHASLRTSFQWEGLESPVQVVH
ARSAPVWRELDWRGLAPEARAQALDAFLREDRAQGFVLSRAPLMRLTLMRLEDRVWRLVW
SFHHLLLDGWSLARVLGEVLDAYAALSRREAWRPPAAMDFRAYVEWLAHREPEQDEAFWR
AQLAGIEAPTPLPLDGAGGHGTGEHTVALGEADTAALQDFARRHGLTPSTLVHGAWALLL
SRHGGTADVVFGTTLAGRPPELPGIEEAVGLFIHSLPLRARIQRGAGVVAWLRELQSTLV
DLGQRGHVPLTRLQGWSDVPRGTPLFESLLVFENYPVDAALARGAAGLELGDFMAFERTH
YPLTAVAVPGPSLRLKLLYRQERVAPDAAARLLSHWSGLLREMLRRPEQRLGEVSLLSEV
ERRRVLVEWNATATAYPRGATVHALFESQATRTPDAVAVRYGETSLTYAELDARANRVAH
RLRGMGVQRGAHVGLCAERSVDLVVGMLGVLKAGGAYVPLDPAYPRERLAWMLADARAQV
LLTQERLRAALPSAGLRVLTFEEVAAEPDTVGAPPPSGAGAEDLAYVIYTSGSTGTPKGV
CVPHQAVVRLVVETNFIHVVPEDRVAQASNASFDAATFEIWGALLNGARVVGVDRETALS
PRAFASWLREEGIRVLFLTTAWFNQVAAEVPDAFGGVRQLHFGGEAVDPRPVRQVLRAGP
PGRLLHVYGPTENTTFSTWHHVTDVPEGATSIPIGRPLANTVQYVLDVDLAPVPPGGVGE
LWLGGDGLAWGYLGQPALTAERFVPDPFSTRPGARLYRTGDRVRLLADGAVTFEGRVDAQ
VKVRGFRVEPGEVEAALLRHPDVRQAVVLAREDDAGGSRRLVAYVVTAAERAATPAVLRA
FLGAHLPAYMVPAVIMPLERLPLTPNGKVDRKALPAPRVETDAHSSMGPEEARVASLFGE
LLGVARVGATDSFFDLGGHSLLATRVVTRLQASFGVVLTLRELFDSPTVAGLAERIRQVR
RSSGPERPPPIIPVSRDAPLPLSAMQERLWLLEQLQPGTALYNVPWAAWLTGPLDVPALE
RALAGLFLRHEALRTTFASNAGEPVQVIHPSADVALPVVDLGALPEAEREAQALHVASEE
ARRPFDLSSGPLCRALLIRTASEAHLLVLTLHHIISDGWSLGVAVRELSALYGAELRGRP
AALPAPTLQPADHAVWQREWLQGEALSAQLDYWREQLAGAPPVLELPKDFPRPGLQRFRG
DTLTVQLPAGLSESFRALCGREGVTPFMGLLAAFQLLLSRVSGQEDVCVGAPIAGRQQPG
LEDLIGFFVNTLVLRARLPRSLSFRELLRQVRETTLEAYAHQDVPFEKLVEALQPPRSLS
HAPLVQVVLALHEPARPDAAPEGLTLRPVELASGTSKFDLTLSLVDAPEGFTGTLEYDAD
LFTRETAARLMQALRVLLESAVADAGQRLGALPMMDAAERQRLLVAWNDTAAEYPREAGL
AALFEAQAARSPDAVAVVCEPAQLTYGELDRRANQLAAYLRKRGVTVGTPVGLCVQRSLD
LVVGMLGILKAGGAYVPLDPSYPRERLAFMVEDTRVPVVLAQRSVLALLPASGADVVLLD
TAWEEVARESHAPLHVEVPAESLAYVMYTSGSTGQPKGVCVPQRAVARLVLGSRFARWGA
DEVFLQLAPICFDAATFELWGALLHGAKLVLFPAQPPTVDALKDVLVRHGVTTLWLTAAL
FEALSAARPDALDGVRQLLAGGDVLPPAAVRERLARGGVLVNGYGPTEGTTFTCCHVMEG
RVAPGPIPIGRPIANTRVYVVDAGLRPVPVGVPGELLIGGDGLAWGYQGQAALTAERFIP
DPFAQAPGGRLYRTGDRVRYREDGALEFLERLDGQVKVRGYRVEPGEVEEALRQHPAVAE
AAVVARPDPAGGKRLVAYAVARAGEALDPRGLRAFLAESLPEFMVPAALMPLAALPLTPV
GKLDRAALPEPEVARPAGSAFVEPTSALERQVAGLWAKVLGVERVGVEDHFFADLGGSSM
SVVKACALLRDELKRDVPATRFFEHPTVRAFTLSLERDGDAAADTQDNEAHVDRAQQRRQ
AIRRQGRRGNHGNG
NT seq 17145 nt NT seq  +upstreamnt  +downstreamnt
atgcactctccactggccgtgacactcctggagttgcttgaaacgcggacccggtcgcac
ggagcgcagccgctctacaccttcctggaggatggcggcgacgacgcggtgctgagctac
gccgggttggacgtgagggcccggcgcatcggcgcggcactccaggcgctgtcacgagcg
ggcgagcgggccgtcctcctgtatccaccgggcctggaatacatcgccgggttcttcggg
tgcctgtacgccgggctgatcgccgtcccggcctatccgccggacccgatgcggttggac
cggaccttgccccgcttgcgcgccatcatccgtgatgcgcgcgcgagcgtcgtgctcacc
acgtccttcatccaggagatgggcgaggggctcttcgaaggcgcgccggagctcgccgcg
ctgcgctgggtggccacggacgcgctcgcggaggggatggaggacggctggcggcgtccg
gcgcccaccggggacacgctggccttcctccagtacacgtccggctccacgggggacccc
aagggggtgcggctcagccacggcaacctgctgcacaacctggggttgatctcccacgcg
ttccaggtccgctcggacagcgtgggcgtcatctggctgccgccgtaccacgacatgggg
ctgattggtggcatcctccagccgctctacgcgggcttccccgtggcgctgatgtcgccg
ctcgcgttcctccgccggccgcggttctggctggaggccctgtcccgcttcggcggcagc
atcagcggggggccctgcttcgcgttcgacctgtgcgtgcggaaggtgccacccgcggag
cgcgaggggctggacctgcgccgctgggagctggcgttctgcggcgcggagcccatccgt
ccggaggtgatggcgcgcttctcggaggcgttcgcgccggtgggcttccagcgggaggcc
ctgtacccctgctacgggttggcggagggcacgctgatcgcatcgggtgggcgcaagggg
gaggggattctcacgcgcacctgggatgcccaggcgctggagcggaacgaggcgctggcg
gtggagggcggccccaatgcgcgtccgctggtcgggtccggccagacgctgcctgaccag
gccttgctcgtggtggatccacagacgcgccttccgtgcccgcctgagcgggtgggggag
atctgggtgtccgggcccagcgtggcgcaggggtactgggagcggccccaggagagcgag
gcggccttcggcgcgcggctggcggacgcggacagcgggccgcggttcctgcggaccggg
gacctgggcctcatgaaggacggcgagctcttcgtcgtgggccggcgaaaggacctcatc
atcctgcgtgggcgcaacctgcacccgcaggacctggagctgacgctggagcgcagccac
ccggcgctgcggcccgggtgtggcgcggcgttcgccatcgacgtgggcggggaggagcgg
ctcgcggtggtgtacgaggtggactcgcgcaagccgtggacgcccgaggacgtggtgagc
gcggtccgccggggcctgtcggagacgcacgaggtccagctccacacgctggtgctcatc
gagccgggggcgctgccgaagacgtccagcgggaagattcagcggcgcgcctgccgggcg
gagctgctcgcggggacgctccgggcgcagctgacgtggagcgaagcggacgcggaggcg
ccgcgggccgaaccgggagcccccgcggtggtcgcgtccgagccgcggaccgtggaggag
ctggaggcgtggctggtggcgcggatcgccgcgcggctccgcgtgcgtcccgaggacctg
acgaaggacgcggccatcacgtccttcgggctggattcgctcggggccgtcgagctggcc
aatgacatcgagtccctgggcgtcgtcctccgcatggaggtcctgctccaaggacccacg
gtggcggagctcgcgcggaccgtcttcgctgcgcgagggaagccgtcgggcgccgagctg
acgcggggcgaggcgacggcgcccgcgcccctgtcgtccgcgcagcagcggctgtggctc
ttcgcgcagctcgcgccaggcagcgccgcgtaccacctgccagcggcggtgcggctcacc
ggcgcgctggacgtggcggcgctggagcgcgccttcgcggccatcctccagcggcacgag
gcgctccgggccacgttccgcgaggaggatgggacgccctggcaggtgagcgcgcccgcc
gcggtgtccgcgctgcggacggtggacctccgcgatgtctcccccgagctgcgggaggcg
accgcgctccggctggcacaggaggcggccagggcgcctttcgagctcgcccacggacct
ctgctccgggccacgctgcttcagctcgcgccccaggagcacctgctcgtcgtggtgatg
caccacctcgcctcggatggagcgtcgttcgccatcctggcgcgggagctgagcgcgctg
tacgcgggagtcgcttcgctgccgccgctggccctccagtacccggacttcgcgcgctgg
cgccgtgaggtcgaggcggaaggggcgatggccaccgccaccgactggtggaaggcgcac
ctggcgggccttcccgccgcgctggagctgcccgcggaccggccgcgtccccccatgccg
tcctactgcggggggcgcgtggccgttcgccttccggaggcgctcacggtccggctggag
gcgctgggccggagtgaaggcgccacgctgttcatgacgctgctggcggccctcgaggtg
ctgctcgcgcgccactccggacaggcggacttctgcgtggggaccgccgtcaacgggcgc
gagcgaagcggcctcgaagggatgatcgggtgcttcctggacctcgtcgtgctgcgcgcg
tccgtcgatggggcatcgcgcttccgggagctgctgggggcggcgcgggagggcgtgctg
gcggcgttcgctcaccgaggcgtccccttcgagcggctggtcgaggccatccagcccacg
agggatccgtcgcgggcgccgctgttccaggtgctcttcgtgctccagccggagcccggc
gccggcctcgcgctgcctgggctggaggcgcgccgcgtggaggtggaccccggcgccacg
ccgtatgacttgacgctgtcgctggcccggagcgccgaggggctgggcggctggctggag
tacgcctcggacctgttcgacgcggacaccgccgcgcggctggtggcgaggctggaggtg
ctcctggaggccgtcgtcgcggacccggagcagcgcgtcggcgcgctgccgctcctcccc
gaggcggagcggcggcaggtgctgaccggatggaacgccacgcggacggacttcccggag
acgtgcgtccacgcgctcatcgaggcccaggcccggcgcacgccggacaccgtggccgtg
gtgtgtggtgacgaagccctgacgtaccgcgagctggaccagcgggccaacgccgtggcg
tggcggctgcgcgagcagggcgtgggcccggagcgcgtcgtggggctcttcgcggaccgc
tccgtggacctggcggtggggctgctgggcatcctcaaggcgggcggtgcctacctgccg
ctggacccgtcctatcccgaggcccgcctcgcgttgatgctggaggactccggcgccgcg
gtggtgctggcgcaccggcacctggcgggagcccttcctgctgggcgtcggacggtggtg
acgctggacgtgcgggcgctggcggacgggccgcctcccatcgccgtggcgccgggcaac
ctcgcctacgtcctctacacctcgggctccacgggcaggcccaagggcgtgctgattccc
caccgcaacgtcgccaacttcttcacggggatggacgcgcgcgtgggggcggcgccgggg
acgtggctggcggtgacgagcgtctccttcgacatctccgtgctggagttgttgtggacg
ctggcccgaggcttcaaggtcgtcgtgcagggcgagcagggggccctgggcgccgcgcct
cgccgcgggggccggacgcgccgcgcgccgctggggttcagcctcttctacttcgcggcg
gatgaaggcgcgccgggcgcggagcgctaccgcctgttgctggagggcgcgcgcttcgcg
gaccgccacggcttccaggccgtgtggacgccggagcgccacctgcacgccttcggcggg
ctctatcccaacccgtcggtgaccagcgcggccatcgccgccatcaccgagcgcgtggcc
atccgcgcgggcagcgtcgtcctgccgctgcatcaccccgtgcgcgtggccgaggagtgg
gcgctcgtcgacaacctgtcgaagggacgggtgggcatctccgtggcgccgggctggcac
gcgaacgacttcgtgctcgcgccggagcggtacgaggaccgccgcgagctggcgcgcggt
gcgctggacaccgtgcggcggctgtggcgcggtgaggcgctccgcttcgccaatggcgcg
ggtgcgtccaccgaggtccgcctccggccgagccccgtgcagcgcgagctgcccgtgtgg
ctcaccgccgccggcaatcccgacaccttccgcgaggcggggaggctgggggcaggtgtc
ctcacgcacctgttgggacagcggtgggaggagctggaggcgcgtatcgcgctctaccgc
gaggcgtggcgtgaggcggggcacgagggcgagggccacgtgacgctgatgctccacacc
ttcgtggggcaggacgtggagcgggtgcgcgagacggtcgaagggccgctgcggcgatac
ctgagcgactccgcggacctgatgcgcggcctggggcggacgctgggcgtggacctggac
ccggcgtcggtccgcccggaggacctggacgcgctggtggggcgcgccttcgggcgcttc
ttcgaaggcgccgggctcttcgggacgccgcgcacctgccgcgaccaggtggcgcgcatc
gaggcgctcggggtggatgaggtcgcgtgcctcatcgacttcggcgtggacacggatgag
gtgctcgccagcctgccggcgctggacgccgtgcggcagcgctgtgagcgggacttccgc
ctccagtcgcagggcgacgacgcggtgcccgcgcagcttcgccggcacggagtcacccac
ctgcaatgcacgccgtccctggcgcaggcgttgcttctggagcccggcgcgccgggggcg
ctcgcgggcctggagcggctgctggtcggtggcgaagcgctgtccgaggcgctggcggcc
cggctgcgcggcaccgtgggcggcgcgctcctcaacatgtacggccccacggagaccacc
atctggtccgcgtcacacgccgtgcgggaggccgcggggccggtgccgatcgggacgccg
atcgccaacacgtcgctgtacgtgctggacgccgcgctgcgcccggtgcccgtgggcgtg
cccggtgagctctacatcggcggcgccggcgtcgcccggggctaccacgcgcggccggag
ctgacggcggagcgcttcctgccggaccccgtggcgtcggaggcgggcgcgcgcatgtat
cggacgggcgaccgggcgcgctggcgggccgacggggcggtggagttcctgggccgggtg
gaccaccagctcaaggtccgcggcttccgggtggagccgggtgaagtcgaagccgtgctg
gcccgtcaccccgccgtggcgcgggccgtggtggtggcgcgagaggacctgcccgggagc
gcccggctggtggcgtacctggtgcctcggctggaggcgtcactctccggggacgcgctg
ctggcctacgcccggcgcgccctgcccgagcacatggtgccctcggcgtgggtgacgctg
gaggccctcccgctgacgcccaacgggaaggtggaccggaaggcgctgcccgcaccggag
ggcgtccgggacgtgggccgggagtacgtggcgcctcggacggagaccgagcgcaggctg
gcggagctgtgggcctcgctcctgggtgtgccgcgggtgggggccgaggacgacttcttc
gccctgggcggccactcgctgctggccacgcgcgccgcgtcgcggattcgcgaggccttc
ggggtcgacctgcccctgcgcgagctcttcgagtcggcttcgcccgcggcgctgggggct
cgtctcgacgcgcgccgtctgcgtgcgtcgggggtccccgcgctgctggcccgctcgcac
gaaggcgcgttgcccctgtccttcgcgcagcaacgcctgtggttcctggagcagctcgag
ccgggtggcgccgcgtacaacgacgcggtggcggtccgggtggagggggcgctcgacgtg
cccttgctggagcgctgcctgcgggaggtggtcctccggcatgacgtgctccgcgccacc
ttccatgaggaggacggggcggcgtcctggcgcgcccacgccgagccccggctcgccctc
acgcgggtggacctgacggcgggggaggccgccgcgcgggcggaggcgctgtcccggcgg
ttggaggcggagtcattgcgggccttcgacctcggggcggggccgccgctccgggtcatg
ctggcccaggtgggcgcgcgtgaacacgtgctcctgctcgtgctgcatcacctggtgacg
gacggcgcctccatgggcgtgctggtgcgcgaggtggccgcgctctaccgcgccttcgcc
aggggcgagccctcgccgctgcccgcgctgccgctccagtatgtggactacgcggcgtgg
cagcgcgactggctgcgtggcgaggcgctggaggcgcagctcgcgtactggcgggcgcgg
ctggagggcgcgcctcgggccttggagttgcccacggaccgtccccgccccgccgtgcgc
ggcagtcggggcgtgagccgcgaggtgtgcctgggggcggagctgacacgtgggttgaag
tcgctggcccggcgcgagggcgccacccccttcatggtgctgctggcgggcttctccgcg
ctgctgtcccgtcacgccgggcaggacgacctgtgcgtggggacgcccgtggcgggccgg
gaccggaccgagctggaggggctcatcggctgcttcgtcaacacgctggtgctccgcgtg
tcgttggcgggcgcgccttccttcctcgagctgattggccgcgcgcgggagacggtgctg
ggtgccttcgcgcaccaggacgcgcccttcgaggagctggtgaaggcgctccagcccgag
cgtgacctgggccgcagcccgctcttccaggccatgctcgtgatgcaggaggatccgctg
ccggagctgacggtccccgggctgcggctgagcgtccagccgcagccgagccacacggcg
aagttcgacctgcggctcatcctcacggacacgcccgagggcttctccgcgaacctggag
ctgagcgccgacctgttcgagcccgacaccgcgtcccgcctgctggagcacctgcgcgtg
ctgctggaggcgggcgtccgctcgccggagcagcgggtctcagacctgccgctgatgtct
ccggcggagcgccaccaggtcctggtggcgtggaacgacacgctccggccgcgaccggag
gcggccgtcctgcatcgcctcatcgaagcgcaggtggaccgcacgccggatgccgtggcc
gtgagcttcgagggagacgcgctcacgtaccgggagctggacctgcgcgccaatcagctc
gcgcgcttccttcgggcccgaggcgtggggccggacacgcgagtcgcccagtgcacggag
cgctcgttggagatggtggtggggttgctgggggtgctcaaggcggggggcgcctatgtg
ccgttggagccggagtacccgcgcgagcgcttggcgttcatgctcgcggacgcggcggcg
cccgtgttgctcacgcaggcgcggctggccgcgggcctgccacacggtggcgcggcggtg
gtgtgcctggactcggagtggggcgtgatttcgcgcgagcccgacacgcggctcgacgtg
gcggtggaggggagcgggctggcgtacgtcatctacacctccggctccacggggcggccc
aagggcgtgatgaacacgcacgccgccatctgcaaccggctccgctggatgcaggaggcc
tacggactcgacgcgagcgaccgggtcctccagaagacgcccttcagcttcgacgtctcc
gtctgggagttcttctggccgctgctgacgggggcccgcctggtgatggcgcgacccggg
gggcaccgggagcccgcgtacctgacggagaccatcgctcgcgagcgcatcaccacgctg
cacttcgtgccctccatgctccggcccttcctggaggagcccggcctggaggcgtcctgc
gccagcctgcggcgggtgttctgtagcggtgaggccctgcccgcggagctgcgggaccgc
tgcttctcgcgcctgggcgcggctctgcacaacctctacggcccgaccgaggccgcggtg
gacgtgacggcgtggagctgcgagcgcgaggaccggcgccccgtcgtgcccattggccgc
cccatcgcgaacacgcggctgtacgtgctggacgctctgctgcgccccgtcccggtgggg
gtgccgggagagctgtacatcggtggcgtggccctggcgcgcggctactggcgccgggcg
gcgctgaccgcggagcgcttcctgccggacgccttcgcggccacaccgggggcgcggatg
tatcgcacgggcgaccaggcccgcttcctggcggacggcgccatcgagtacctggggcgc
ctggacgaccaggtgaaggtgcggggcttccgcatcgagccgggcgagattgaagcggcg
ctggcccggcaccccgacgtgcgggcggcggcggtggtggtccgggaggacgtcccggga
gaccggcgcctcgtggcgtatgtggccggggctccagcggacggcggcgcggcgctgcgc
gcgttcctgggggagcgcctgcccgagcacatggtgccgtcggcgttcgtctcgatggag
gccctcccgctgtcgcccagtgggaagctcgaccggcgcgcgctccccgcaccaccgcgg
gccgtgcccggggagggcgcgggcttcgtggcgccacgcaacgagcaggagcggcagctc
gcgcgcatctgggcgggggtgctgggcgtcgagcgggtgggcgtcgaggaccgcttcttc
gaactgggcggcgactccatcctcgcgcttcaggtgattgcgcgggcgcggcaggtgggc
ctccacctcacggcgcgtcagctcttccagcatccgacggtggcggccctggcccaggtg
gcgggcggcgtccgccgggcgggtgaacaaggcccggtggtggggcccgttcccctgacg
cccatccagcggtggttcgtcgagcgcgagctgcccgagccgcaccacttcaaccaggcg
ctgatgctggagccgcgtgagcccctggcgccagaggtgctggctcgcgcgctggcggcg
ctggtggaccaccatgacgcgctccggttgcggctgtcacgggcggataccgggtgggcg
cagtcgtgcgacgagcctgggcgtgaggtgccgctgcggcgggtggacctgaccgggctg
gaggtgccggagcaggccgaggcgatggcgcgagtcgccgctgaggtgcaagccgggctg
gacctggcgtccggctgtctcttgagcgcggtgctgttcgaacgggggagggcgcgggcg
ggccggttgttgctggtcatccaccacctggcggtggacggcgtctcctggcgtgtgctg
ctggaggacctggagaccgcgctccggcagcttgcccgtggcgagcccgtggcgctcccc
gcgaagacgacgtccttccaggagtgggcgcggcggctggaggtccatgcggcctctgcg
tcagtcgcgggggagcgggccttctggcgcgaaacaacgagcgcggaggtgtctccgctg
ccgcgtgacttcgcggacggggtgaacacgcaggggtcggagcgcgtcgtcaccgtggcg
ttggcggccgacgtgacgcgctcgctgctgcgttcgacgggcgccgcgccggaggaggtg
ctcctcgcgggcgtggcgtgcacgctgtccaggtggaccgggcagcgccgcttgcgcatc
gacctggaggcccacggtcgcgaggagctgttcgaggacgtggacctgtcccgcacggtg
ggctggttcacctcgctgttccccgtgcggctggaggtgtccgaggagcccgcctccgcg
ctggcctcggtccgggcctcgcgtgagcaccgcaagggcagggggctcgggtatggcctg
ctccgctacctgcgtcgcgaggatgacgtcccggcggccgtcggggcgggcgcctcgtcc
gaggtgctcttcaactacctggggcagctcgactcgggcgcgcgggagtccgcgctgttc
gccctggccgccgagcccacggggccctcgcaggggacgcgcgggcttcgaagtcacgcg
ctggaggtcgtggcgcgcgtcgttggcggacggctggagctggcgtggcactacagcgag
gcgctgcatgctcgcgagcgcatcgaggccctggcgcgggagtgccgggaggtgctggcg
gagctcgcgggcgcgacggagcagcggtctccgctctcgcctctccagcatggcttgttg
ttccaggtgctgctggagcccgggacggaggcgtacttcgagcagcgaagctgggcgctc
tccgggcccttggaccccgaagcgctgcggcgcgcgtgggaggctgtgtccgaacggcat
gcctcgctgcggacctccttccaatgggagggcctggaatctcctgtccaggtcgtccac
gcgcggagcgctcccgtctggcgtgagctggattggcgtgggctcgcccccgaggcccgg
gcccaggcgctggacgcgttccttcgtgaggaccgggcccagggcttcgtgttgtcgcgc
gcgccgttgatgcggttgacgctgatgcggctggaggaccgcgtctggcgcctcgtctgg
agcttccaccatctgctgctggatgggtggagcctggcgcgtgtgctcggtgaggtgctg
gacgcctacgcggcgctctcgcgtcgcgaggcctggcgcccgcccgccgcgatggacttc
cgcgcctacgtcgagtggctggcgcaccgcgagcccgagcaggacgaagccttctggcga
gcgcagctcgcgggcatcgaggctccgacgccgttgcccctggacggcgctggcggacat
ggcacgggtgagcacaccgtggcgctgggggaggccgacacggcggcgctccaggacttc
gcgcgccgtcacgggctgacgccgagcaccctggtccatggggcgtgggcgctgctgttg
tcccgccatggtggcacggcggacgtcgtgttcgggacgacgctggcgggccgtccgccg
gagctgccgggtatcgaggaggcggtggggctgttcatccactcgctcccgctgcgagcc
cgcatccagcgcggcgccggggtggtggcctggctgcgcgagctccagtccacgttggtc
gacttgggccagcgcgggcacgttccgctcacgcggctccaggggtggagcgacgtgccc
cgaggcacgccgctcttcgagagcctcctggtcttcgagaactacccggtggacgcggcg
ctcgcgcgtggcgcggcggggttggagctcggggacttcatggccttcgagcggacccac
tatccgctgaccgccgtggcggtcccagggccgtcgttgcgcctgaagctgctctaccgg
caggagcgcgtcgcgcctgacgccgcggcgaggctgctgtcgcactggagcggcctgctc
cgggagatgctccgtcggccggagcagcggttgggcgaggtgtccctgctgtcggaggtg
gagcgtcgccgggtgttggtggagtggaatgccaccgccaccgcgtacccgcgtggcgcc
acggtgcacgccttgttcgagtcccaggccacgcggacgcctgatgcggtcgcggtgcgc
tatggcgagacgtcgctgacctacgccgagcttgacgcccgggcgaaccgggtggcccat
cggctgcgcgggatgggcgtccagcgaggggcgcatgtggggctctgcgcggagcgctcg
gtcgacctcgtcgtggggatgctgggtgtcctcaaggcgggtggggcctacgtgccgttg
gatccggcgtacccccgcgagcggctcgcgtggatgctcgcggatgccagggcccaggtg
ctgctgacccaggagcggctgcgggcggcgctgccctcggcggggttgcgcgtgctcacg
ttcgaggaggtcgcggcggagccggacactgtcggtgcgccgccgccttcaggggctggc
gccgaggacctggcgtacgtcatctacacctccggctccaccgggacgcccaagggtgtc
tgcgtcccgcatcaagccgtggtccggctggtggtggagacgaacttcatccacgtggtg
ccggaggaccgcgtggcgcaggcgtccaacgcctcgttcgacgcggccacgttcgaaatc
tggggcgcgttgctcaacggcgcgcgggtggtgggcgtggaccgggagacggcgttgtcg
ccccgggcgttcgcgtcgtggctgcgcgaggagggcatccgggtcctcttcctcaccacg
gcctggttcaaccaggtggccgccgaggtgccggacgccttcggtggggtgcggcagctc
cacttcggcggtgaggccgtggacccccggccggtgcgccaggtcctgcgcgcggggccg
cccgggcggctgctccatgtctatgggcccacggagaacaccacgttctccacgtggcac
cacgtcacggacgtgccggagggcgccacctccatccccattggcaggccgctggcgaac
accgtccagtacgtgctcgacgtggacctggcgccggtgccgcctgggggtgtgggagag
ctgtggctcggaggggatggcctggcgtggggctacctgggacagcccgcgctgacggcg
gagcgcttcgttccggacccgttcagcacgcgtcccggggcgcggctctaccggacgggg
gaccgggtccgcttgctcgcggacggcgcggtgacgttcgagggccgcgtggacgcgcag
gtgaaggtgcgcggcttccgcgtggagccgggcgaggtcgaggccgcgctgctgcgtcac
cccgatgtccggcaggccgtggtgctggcgcgggaggatgacgcagggggctcgcggcgc
ctggtggcctatgtcgtcacggcggcggagcgcgccgcgacgcccgcggtgctgcgcgcc
ttcctgggcgcgcacctgccggcgtacatggtgccggcggtcatcatgccgctggagcgc
ctgccgctgacgcccaacgggaaggtggaccgcaaggcgctgccggcgccgcgggtcgag
acggacgcccactcgtcaatggggcccgaggaggcgcgggtcgccagcctctttggcgag
ctgctcggcgtcgcccgcgtcggggcgacggacagcttcttcgacctgggcgggcactcg
ctgctggccacgcgggtcgtcacgcggcttcaggcgtccttcggcgtcgtcctgacgctg
cgggagctcttcgactcaccgaccgtggcggggctggccgagcgcatccggcaggtccgc
cggtcttccggtccggagcgcccgccgcccatcatccccgtctccagggacgcgccgctg
ccgctgtccgcgatgcaggagcgcctgtggctgctggaacagctccagcccggcacggcg
ctctacaacgtcccctgggccgcgtggctcaccggaccgctggacgtgcccgccctggag
cgggcgctcgcggggctgttcctccgtcacgaggcgctgaggaccaccttcgccagcaac
gcgggggagcccgtgcaggtcatccacccgagcgccgacgtggcgctcccggtcgtggac
ctgggcgcgttgccggaggcggagcgggaggcgcaggcgctgcacgtcgcttcggaagaa
gcgcgccggccgttcgacctgtccagcgggccgttgtgccgggcgttgctcatccggacg
gcgtcggaggcgcacctgctggtcctcacgctgcatcacatcatctccgacgggtggtcc
ctgggggtggccgtgcgggagctgtcggcgctgtacggggcggagctgcggggccgaccc
gcggcgctgccagcgcccacgctccagcccgcggaccacgcggtgtggcagcgtgagtgg
ctccagggagaggcgctctccgcgcagctcgactactggcgcgagcagctcgctggagcg
ccccccgtcctggagctccccaaggacttcccccggccgggcctgcaacgcttccggggc
gacaccctgaccgtgcagctccccgccgggctgtccgagtccttccgtgcgctgtgcggg
cgcgaaggcgtcacgcccttcatgggcctgctggccgccttccagctcctgctgtcgcgc
gtgtcggggcaggaggacgtgtgcgtgggggcgcccatcgcgggccggcagcagcccggg
ctggaggacctgatcggcttcttcgtcaacacgctggtgttgcgcgcgcgcctgccgcgg
tcgctgtccttccgtgagctgctgcgccaggtgcgggagacgacgctggaggcctacgcc
catcaggacgtcccgttcgagaagctggtggaggcgctgcagccgcctcgcagcctgagc
cacgcgccgctggtgcaggtggtgctcgcgctccacgagcccgcgcgcccggacgcggcg
cccgaggggctcaccctgcgccccgtggagctggcctcgggcacgtcgaagttcgacctc
acgctgtccctggtcgacgccccggagggcttcacgggcacgctggagtacgacgcggac
ctcttcacccgggagacggccgcgcggctgatgcaggcgctccgggtgttgctggagagc
gcggtggccgacgcgggccagcggctgggcgcgctgccgatgatggacgcggcggagcgt
cagcgcctgctggtggcgtggaacgacaccgcggcggagtacccccgggaggcggggctc
gcggcgctcttcgaggcccaggcggcccggtcgccggacgcggtcgcggtggtctgcgag
ccggcgcagctcacgtacggggagctggaccggcgggcgaaccagctcgcggcgtacctg
cgcaagcggggcgtgacggtggggacccccgtggggctgtgtgtccagcgctcgctcgac
ctggtggtggggatgctgggaatcctcaaggcgggcggcgcctacgtgccgctggacccc
tcgtatccccgcgagcgcctggccttcatggtggaggacacgcgcgtgccggtggtgctg
gcgcagcggtccgtgctggcgctgctgcccgccagcggcgcggacgtggtgctcctggac
acggcctgggaggaggtggcgcgcgagtcccacgcgcccctccacgtcgaggtgcccgcg
gagtcgctggcctacgtcatgtacacgtcaggctccacggggcagccgaagggcgtctgc
gtcccgcagcgcgcggtggcccggctggtgctgggctcgcgcttcgcgaggtggggcgcg
gacgaggtcttcctccaactggcgcccatctgcttcgacgccgccaccttcgagctgtgg
ggcgcgctgctgcacggcgcgaagctggtcctcttccctgcgcagccgcccacggtggac
gcgctcaaggacgtcctggtccgtcacggcgtcaccacgctgtggctgacggccgcgctc
ttcgaggcgctctccgccgcgaggccggacgcgctggacggcgtgcggcagctcctggcg
ggcggtgacgtgctccctccggccgcggtgcgggagcggctcgcgcggggcggcgtcctg
gtcaacgggtatgggcccaccgagggcacgacgttcacctgctgccacgtgatggagggg
cgcgtcgcgccgggccccatccccattggccgtcccatcgccaacacgcgcgtgtatgtg
gtggacgcggggttgaggccggtgcccgtgggcgttccgggcgagctgctcatcggcgga
gacggcctggcctgggggtaccagggacaggcggcgctgacggcggagcgcttcatcccg
gacccgttcgcccaggcgccgggtggccggctgtaccgcacgggcgaccgcgtgcggtac
cgcgaggacggcgcgctggagttcctggagcgcctggatgggcaggtgaaggtgcgcggc
taccgggtggagccgggcgaggtggaggaggcgctgcgccagcacccggccgtggccgag
gcggcggtggtggcgcggccggaccccgcgggaggcaagcggctggtggcgtacgcggtg
gctcgggcaggggaggcgttggacccacgggggctgcgcgccttcctggcggagtccctg
cccgagttcatggtgcccgctgcgctgatgccgctggccgcgctgccgctcacgcccgtg
ggcaagctggaccgcgccgcgttgccggagccggaggtcgcgcgcccggcgggcagcgcc
ttcgtggagcccacctccgcgctggagcgccaggtggcggggctctgggcgaaggtgctg
ggcgtggagcgggtcggtgtggaggaccacttcttcgcggacctgggcggcagctccatg
tccgtggtcaaggcgtgcgcattgctgcgcgacgagctgaagcgcgacgtcccggcgacg
cgcttctttgaacatcccacggtccgcgcgttcaccctgtccctggagcgggacggcgac
gcggcggcagacacccaggacaacgaggcccacgtggatcgcgcccagcagcggcgtcag
gcgatccgccgtcagggccggcgaggaaatcacggcaatggctga

DBGET integrated database retrieval system