KEGG   Myxococcus macrosporus: MYMAC_003984Help
Entry
MYMAC_003984      CDS       T05096                                 

Definition
(GenBank) hypothetical protein
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LRR_4 LRR_8
Motif
Other DBs
NCBI-ProteinID: ATB48357
UniProt: A0A250JXZ3
LinkDB All DBs
Position
4960121..4962019
Genome map
AA seq 632 aa AA seqDB search
MRATVAKCDAVGPIPPCSGVSLRAGFLRFAGLILGLAACATTRPAPVIPSPAASPVVVTA
PRRLLTVFQLAPDGTRDELGQLPPGPEGFTPPDSGDWYAAPLLPVRTEVEARDLAAVLRE
HRVPGVSFDGAAVPGPEVLRVLLQGSHVVALHVSGTNFGDAHLAALEDAPRIEALHLSAT
RLTNSGLAPLERMRRLAVLRLDETSVSDPGLASLSEHTTLRRVSLAGTAVTSRGLEFLAR
QPELEELDLSDTSVDDTVLASLPGARLHTLSLSGTRVTDRGLRALTSLPTLRRLGLARTT
VSDAGLRHATGLRALEALHLGSTRVTDAGLVHLAKLPGLRALVLSKAGIRGAGLRHLAGL
SRLEVLHLDDTRVGDAALRHLHGLLGLRELDLSRTTVTGAGLQELSNLVALESLLLSGLA
LTDGSLTRLAPLSRLTRLDLSRTPIGLEALNNLGPRFHLRHLDLSRTGFTDEWVSTTCQL
FPGLHALKAERTLLTDVGLGQLAGLTELEAIHVAGTLISGSGLTGLHALTRLTKLDLGAT
RLDAQGQKALLGFKRLVWLSLAGIRSGDELLGHLPSSLRTLYLTRTNVTDAGLPALRQLP
GLQELDLRGTTVSAEARQTLVQEHGIRLITGL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
ttgagggcgacggtcgcgaagtgtgacgcggtgggaccgattccaccctgttcgggggtg
agtttgcgcgcaggcttcctgaggttcgcgggattgattctcggcctggccgcatgtgcc
accacccgccccgcgcccgtcatcccctcccctgccgcaagccctgttgtcgtcacggct
ccccggcggctcctcacggtgttccagctcgctccggatgggacccgcgatgagctcggg
cagttgccgccagggcccgaaggattcaccccacctgactcgggcgactggtacgccgcc
cccctgttgcccgtgcggaccgaagtggaggcacgcgacctcgccgccgtcttgcgcgag
caccgcgtgcccggcgtgtccttcgacggcgccgctgtccccggccccgaagtgctccgg
gtgctactgcagggctcccatgtcgtcgctcttcacgtgtccgggacgaacttcggcgac
gcgcacctcgccgcgctcgaggacgcgccccgaatcgaggccttgcatctcagcgccacc
cggctcaccaactcagggttggcccctcttgaacggatgcggcggctggcggtgctgcgg
ctggatgaaacatctgtctcggacccgggccttgcgtcgctttcggagcacaccaccctg
cgccgcgtgtcgctcgccgggacagccgtcacgtcccgggggctcgaattcctcgcgcgg
caaccggagttggaggaactggacctctccgacacctccgtggacgacaccgtcctcgcc
tcgctgccgggcgctcggctccacacgctcagcctgagcggcacgagggtaacggaccgg
ggcctccgggcactcacaagcctgcccaccctcaggcggctgggcctcgcgcggacgacc
gtgtcggatgccggcctcagacacgcaacgggacttcgtgcgctggaagcccttcatctg
ggcagcacgcgggtgaccgacgcagggctggtccacctcgcgaagctgcccgggcttcgt
gcgctggtcctcagcaaggcgggaatccggggagcgggcctgcgtcacctcgcgggcctg
tctcggctggaagtactccatctcgacgacacccgcgtaggcgacgcagcgctgcgccat
cttcacgggctcctcggtctccgagagctggacctctcccgcacgaccgttacgggcgcg
ggacttcaggaattgagcaacctggtggcgctcgagtcactcttgctctcaggtctcgcc
ctgacggacggctccctgacgcgcctcgccccgctcagccgcctgaccaggctcgatctc
agccgcacccccattggcctggaggcgttgaacaacctgggtccacgcttccacctgcgc
catcttgacttgagccggaccgggttcacggacgaatgggtgtccaccacgtgccagctc
ttccctggcctccacgccctgaaagcagaacgcacactcctgacggacgtgggcctgggt
cagctcgccgggctgacggagctggaggccatccatgtcgcggggacgctcatcagtggc
tccggcctgacgggcctgcacgcccttacccggctcacgaagctggacctgggcgcgacc
cggttggacgcacagggacagaaggcgctcctgggcttcaagaggctcgtctggctgagc
ctcgccgggattcgcagtggggacgagctgctcggccacctgcccagctcgctccgcacc
ctctacctgacgcgcacgaacgtcaccgatgcggggctcccggcgttgcgccagctacca
ggcctccaggaactcgacctgcgcggcaccacggtgtccgcggaggccagacagaccctg
gtccaggaacacggcatccgcctcatcacggggctgtga

DBGET integrated database retrieval system