KEGG   Myxococcus macrosporus: MYMAC_004321Help
Entry
MYMAC_004321      CDS       T05096                                 

Definition
(GenBank) peptide synthetase
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C_2
Motif
Other DBs
NCBI-ProteinID: ATB48692
UniProt: A0A250JYZ2
LinkDB All DBs
Position
5442278..5444008
Genome map
AA seq 576 aa AA seqDB search
MPSPSHSVQTLTDLLRWRASNQPEANAYTYLQDGEGQELTWTYRELDRQARAIAAALQEH
KGAGERALLLYPPGLDYIAAFFGSLYAGVAAVPAYPPAQLQAVNRILSILQDAKPRFALT
TREILESVNALADAYPVLRDIRWIATDALEEGLEDGWKRPAITGDSLAFLQYTSGSTSTP
KGVMVLHRNLMSNESMIQQGFSHDEQTTVCGWLPLYHDMGLIGTVLQPMYMGVHSVVMSP
WSFLQRPIRWLSAITKYRATTSGGPNFAYALCTRKVKPEQLASLDLSSWRVAFNGAEPVR
AETLSQFADTFAPAGFRREAFYPCYGLAEATLFVSGGLASEVPRGLTVEAAALEQNRVVP
AQPGPSTWTFVSAGRSWGDCLIRIVNPETLVACAPNEVGEIWTAGPHVTHGYWGREDTNA
ETFQARIQGSEEGPFLRTGDLGFMMDGELYVTGRIKDLIIVDGRNHYPQDIELTAERQHE
ALRPGCSVAFSVDHPEGERLVVLVEVNARHAPADPGADASALQKTLRQAVAAAHSVDVHE
VVLLQQGEVLKTSSGKVQRRACKAKYQEGSLQRWPA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagtcccagccattccgtgcagaccctcaccgacctgctgcgctggcgcgcctcg
aaccagcccgaggccaacgcctatacctacctccaggatggagaaggccaggaactcacc
tggacctatcgcgagctggaccgccaggcccgcgccatcgccgcggcgctccaggagcac
aagggcgccggtgagcgggcgctgctgctgtatccgccggggctcgactacatcgcggcg
ttcttcggcagcctgtacgcgggcgtcgccgcggtgccggcctatccgcccgcgcagctc
caggccgtcaaccgcatcctctccatcctccaggacgcgaagcctcgcttcgcgctcacc
acgcgcgaaatcctggagagcgtgaatgcgctggcggacgcctacccggtgctgcgcgac
atccgctggattgccacggacgcgctggaggaaggactggaggacggctggaagcgcccg
gccatcaccggcgattcgctggccttcctccagtacacctccggctccacgtcgacgccc
aagggcgtgatggtgctgcaccggaacctgatgtccaacgagtcgatgattcagcagggc
ttcagccacgacgagcagacgacggtgtgcggctggctgccgctgtaccacgacatgggc
ctcatcggcacggtgctccagccgatgtacatgggcgtccactccgtcgtgatgtcgccc
tggtccttcctgcagcggcccatccgctggctgtccgccatcacgaagtaccgcgcgacg
accagcggtggtcccaacttcgcctatgcgctctgcacgcggaaggtgaagccggagcag
ctcgcgtcgctggacctgagctcctggcgcgtggccttcaatggcgccgagcccgtgcgc
gcggagacgctgtcgcagttcgcggacaccttcgcgcccgcgggcttccggcgggaggcc
ttctacccctgctatgggctggcggaggcgacgctgttcgtgtcgggaggcctcgcctcc
gaagtgccacgcggcctcaccgtggaagcggcggcgctggaacagaaccgcgtcgtgccg
gcgcagccgggcccgtccacctggaccttcgtcagcgccgggcgaagctggggggactgc
ctcatccgcatcgtgaatccggagacgctggtggcctgcgccccgaacgaggtgggcgaa
atctggacggccggtccccacgtcacccacggctactggggccgcgaggacacgaacgcg
gagaccttccaggcccgcatccagggcagcgaggaaggccccttcctgcgcaccggcgac
ctgggcttcatgatggacggcgagctgtacgtcacgggccgcatcaaggacctcatcatc
gtcgacggccggaaccactacccacaggacatcgagctgacggccgagcgccagcacgag
gccctgcgtcccggctgctcggtggcgttctccgtcgaccacccggagggagagcggctg
gtggtgctggtggaggtcaacgcccgccacgcaccggccgaccccggcgcggacgcgagc
gcgctccagaagaccctccggcaggcggtggccgccgcacactccgtggatgtccacgag
gtcgtcctgctccagcagggcgaggtcctcaagacgtccagcggcaaggtccagcggcgc
gcgtgcaaggcgaagtaccaggagggcagcctccagcgctggccggcgtag

DBGET integrated database retrieval system