KEGG   Myxococcus macrosporus: MYMAC_004431Help
Entry
MYMAC_004431      CDS       T05096                                 

Definition
(GenBank) peptide synthetase
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation Bac_luciferase PP-binding AMP-binding_C Flu_NS1
Motif
Other DBs
NCBI-ProteinID: ATB48800
UniProt: A0A250JYT6
LinkDB All DBs
Position
complement(5583351..5589806)
Genome map
AA seq 2151 aa AA seqDB search
MTEHIEPRAHRFPTLVDVLCQRAESQGDALLYRFLETGDVDGPVEEWSYRRLDSRARSLG
ARLRALGAQGERALLLYPPGLEFVAGFMGSLYGGVIAVPCYPPDPTRLDRTLPRLRAIAR
DCGARYVLTTTFIQEMAEFLTPQAPELGELQWIASDAVPESEAAGWKRPELTPDSLAFLQ
YTSGSTGNPKGVKVSHANILHNESLITRDFGLQAERSVGVGWLPMFHDMGLIGKVLQPLY
LGFPCVLMSPIAFLQRPLRWLEAVSHFKGTCSGGPNFAYDLCARKARAEDVARLDLSHWD
LAFNGAEPVRRETMERFAETFAPAGFKREAFYPCYGLAEATLIVSGGVKGTPCVQARFDT
AALELGRAKLAPDVAEGPAARTLVSSGQGAPDQRLLIVDPETRTPRAPHEVGEVWVSGPS
VANGYWDRPEETAHAFGARLASGEGPFLRTGDLAFLSPEGELFITGRLKDLLIVRGRNLY
PQDLEMTAERAHRAVRPGCSAAFSVEVEGEERLVVVSEVDVREGFDGAAVVGALRSALAD
EHQVHAHTVVLLQARSIPKTSSGKIQRRACRDGFLAGTLEVVELSGEEAAPVPDTAPAAP
LRERLSLAADDARPALLEDFLRVEAARVLRAAPASLAPDTSLASLGLDSLMALELHGRLE
EELGVSLPVAFLWQHPTLGAAAAHLVEAWKGAAAPAVPPLKAGPLDGELPLSPGQQRLWF
LDRLVPESPLYNVHFQLRLSGALDVPALERALQGLVSRHAVLRAAFPEVEGQPRQHLSPS
RPLEVAHADLRALPAAEREAQVGQLARTQGETPFQLAEGPLVRAALVALEDQEHVLLMTQ
HHIVTDGWSIGVLARELAALYRAEVSGGAAALGAPALQYVDYARWQRGLEGALDGQRAYW
ARKLENLPRLELPTDFPRPREPGFRGALHRFTLPADLVESLKGVGRGEGCTFFVTLSAAW
AALLHRYSGQDDFGLGTIFAQRDRAELREVVGFFASTLVLRADVSGSPRFRELLGRMRRT
FHEALANADLPFEEVVGAARAARGGDNPLFQANLVLESLPPVDMDVPGMQWRPVLPVPDG
AVEGTAKFDLQLAVVETARGLDAALEYRTDLFTPATMARLAGHLEALLRGIVATPDARVD
DLPLLDEAERRALLVDWNDFTAPLSPEPSHCIHAQFREQAARTPDAVAVAAEDGALTYAE
LSRRASALALHLRGLGVGPEVRVGLCAERSVEMVVGMLGILEAGGAYVPLDPDYPRERLT
YMLEDSGARVLVTQSHLAGTLPVAGLHAVLLDTAEPYAASPASPLAQGTTPDNAAYVIYT
SGSTGRPKGVVVPHGSVANFFAAMDVRVGHSPAGAWLAVTSISFDISVLELLWTLTRGFK
VVVQGEGGSLKAPARAAGARKRPMDFSLFYFADDAEASRGESSYKLLMEGAKFADTHGFA
AVWTPERHFHAFGGLYPNPSVAGAAVAAVTKRVAIRAGSVVLPLHHPVRVAEEWSLVDNL
SGGRVGISVASGWHANDFVFAPEKYEKRRELMMEGIDTVRRLWRGETVRFPGGGGAQVDV
KLRPRPVQAELPVWLTAAGNPETFITAGRMGCNILTHLLGQTWEDLEKKLGLYRQAWRDA
GHAGEGHVTLMLHTFIGEDAAKVREVVEQPFRNYLKSSADLMRGLGSTLGIDMNSATEAD
LDRLAGHAFDRYFETSGLFGTPRSVRERIGQLQELGVDEVGCLIDFGIPADTVLASLPLL
DEVRQRCVRDSRRAGTAKSIPEQLREHGVTHLQCTPSLARALLAEPESAEALGNLRRLMV
GGEALPGALAASLRQALPASAELLNMYGPTETTIWSSTARVAAEETAAVVSIGTPLLRTR
FYVLDALLRPAPVGVAGELYIGGSGVVRGYLGRPELTAERFIPDAWSNEPGARLYRTGDR
ARWRADGTMEFLGRVDYQLKVRGFRIEAGEIEAALTAQPAVRESVVVAREDVPGDVRLVA
YVVPQSGAAVDVAALRDALAQRLPEHMVPSLVVELPALPLTPNGKVDRKALPAPNVVRSA
KAAFVAPQGQLEEQIAQVWRSVLRVEQVGVHDNFFDLGGHSLLMVQVHAQLKSVLGQDLP
LLKLLEHPTISTLARFARQDAGAGQSQVEAAQDRAKRQLESLKRQRQRARK
NT seq 6456 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcacatcgagccgcgggctcaccgtttccccaccctggtggacgtgttgtgt
caacgcgccgagtcccaaggcgacgcgctgctgtatcgcttcctggagacaggagacgtg
gacggcccggtggaggagtggagctaccggcggctggattcacgggcgcgctcgctgggg
gctcggctgcgtgccctgggggcgcagggggagcgggcgctgctgctctacccgccaggg
ttggagttcgtcgcgggcttcatgggcagcctctacggcggcgtcatcgccgtgccgtgc
tacccgccggaccccacgcgcctggaccgcaccttgccccgcctgcgcgccatcgcgcgt
gactgcggcgcgcggtatgtgctgacgaccaccttcatccaggagatggcggagttcctc
acgccgcaggcgcccgagctgggggagctgcagtggatcgccagcgacgccgtccctgag
tccgaggccgccggctggaagcgcccggagctgacgcctgactcattggccttcctgcaa
tacacgtcggggtccacgggcaacccgaagggtgtcaaggtcagccacgccaacatcctc
cacaacgagtcgttgattacgcgtgacttcggcttgcaggcggagcgctccgtcggcgtt
ggctggctgcccatgtttcatgacatgggtctcatcgggaaggtgctccagccgctctac
ctggggttcccatgcgtgctgatgtcacccattgcgttcctccagcggcccctgcgctgg
ctggaggccgtctcccacttcaaggggacgtgcagcggcgggcccaacttcgcgtatgat
ttgtgcgcgcggaaggcccgcgccgaggacgtggcccgcctggacctgagccactgggac
ctggccttcaacggcgcggagcccgtgcggcgcgagacgatggagcgcttcgcggagacc
ttcgcgcccgcggggttcaagcgcgaggccttctatccctgctacggcctggccgaggcg
acgctcatcgtcagcggcggtgtgaagggcacgccctgcgtgcaggcgcgtttcgacacc
gccgcgctggagctgggccgcgcgaagctggcgccggacgtggcggagggccccgcggcg
cgcacgctggtgtcgtccggacagggcgcgccagaccagcggctgctcatcgtggacccg
gagacgcgcacgccccgggcgcctcacgaggtgggcgaggtgtgggtgtccggccccagc
gtggcgaatgggtattgggatcgcccggaggagacggcgcacgcctttggcgcgcggctc
gccagcggcgagggcccgttcctgcgcaccggcgacctggccttcctgtcgccggagggg
gagctgttcatcaccggccggctcaaggatctgctcatcgtccggggccgcaacctgtac
ccgcaggacctggagatgaccgcggagcgcgcgcaccgcgcggtgcggcccgggtgcagc
gccgccttctccgtggaggtggagggggaggagcggctggtggtggtgtccgaggtggac
gtccgcgagggcttcgatggcgcggcggtggtgggcgccctgcgcagcgcgctcgccgac
gagcaccaggtgcacgcgcacacggtggtgctgctccaggcccgcagcatcccgaagacg
tccagcggcaagattcagcggcgggcctgccgtgacggcttcctggcgggcacgctggag
gtggtggagctctcgggcgaggaggccgcgccggtgccggacaccgcgcccgcggcgccg
ctgcgcgagcgcctgtccctggcggccgatgacgcgcgcccggccctgctggaggacttc
ctccgcgtggaggccgcgcgggtgcttcgcgcggcgcccgcgtccctggcgccggacacg
tccctggccagcctggggttggactcgctgatggcgctggagctgcacggccggctggag
gaggagctgggcgtgtcactgcccgtggcgttcctctggcagcacccgacgctgggcgcc
gccgccgcgcacctggtggaggcgtggaagggcgccgccgcgcccgccgtgccgccgctg
aaggcgggcccgttggacggggagctgccgctgtcgcccggccagcagcgcctgtggttc
ctggaccggctggtgccggagagcccgctgtacaacgtccacttccagctccggctctcc
ggggcgctggacgtccccgcgctggagcgcgcgctccaggggctcgtgtcgcgtcacgcc
gtgctgcgcgcggccttccccgaagtggaggggcagcctcgccagcacctgtcgccctcg
cgcccgttggaggtggcccacgccgacctgcgcgcgttgccagcggcggagcgtgaggcg
caggtggggcagctcgcccggacccagggggagacgccgttccaactggccgaaggcccg
ctggtgcgcgcggcgctggtggcgctggaggaccaggagcacgtgctcctgatgacccaa
caccacatcgtcacggacggctggtccattggcgtgctggcccgggagctggccgcgctg
taccgcgcggaggtgtcgggcggggccgcggcgctgggcgcgcccgcgttgcagtacgtg
gactacgcccgttggcagcgtggcctggagggcgcactggatgggcagcgcgcctactgg
gcccggaagctggagaacctgccgcgcctggagctgcccacggacttcccccgcccgcgc
gagccgggcttccgcggcgcgctccaccgcttcacgttgcccgcggacctcgtggagtcg
ctcaagggggtggggcgcggcgagggctgcaccttcttcgtcacgctctccgcggcctgg
gcggcgctgctgcaccgctacagcggccaggacgacttcggcctgggcaccatcttcgcc
cagcgggacagggcggagctgcgcgaggtggtgggcttcttcgccagcacgctggtgctc
cgcgcggacgtctccggttcgccccgcttccgcgagctgctcggccgcatgcgccgcacc
ttccacgaggcgctggcgaacgcggacctgcccttcgaggaggtggtgggcgcggcgcgc
gcggcgcgcggcggtgacaatccgctgttccaggcgaacctggtgttggagagcctgccg
ccggtggacatggacgtgccgggcatgcagtggcgcccggtgctgcccgtgccggacggc
gccgtggagggcaccgcgaagttcgacctgcagctcgcggtggtggagacggcgcgaggg
ctggacgcggcgctggagtaccgcacggacctcttcacgcccgcgacgatggcgcggctc
gccggccacctggaggccctgctgcgaggcatcgtcgccacgccggacgcgcgcgtggac
gacctgccgctgctcgacgaggccgagcgccgcgcgctgctggtggactggaacgacttc
acggcgccgctctctccagagccgtcgcactgcatccacgcgcagttccgtgagcaggcc
gcccgcacgcccgacgccgtggcggtggccgccgaggatggggcgctcacctacgcggag
ctgtcgcgccgcgcctccgcgctggccttgcacctgcgcggcctgggcgtggggcccgag
gtgcgcgtgggcctgtgcgccgagcgctcggtggagatggtggtggggatgctcggcatc
ctcgaggctggcggcgcctacgtgccgctggacccggactatccccgggagcggctgaca
tacatgctggaggactctggcgcgcgcgtgctcgtcacgcagtcgcacctggcgggcacg
ttgcccgtggccggcctccacgccgtgctgctggatacggcggagccctatgccgcatcg
ccggcgtctccgctggcccaggggaccacgcccgacaacgcggcgtatgtcatctacacg
tccggctccacgggccgccccaagggcgtggtggttccgcatgggagcgtggccaacttc
ttcgcggccatggacgtgcgcgtgggccactcgcccgcgggcgcgtggctggccgtcacc
agcatctccttcgacatctccgtcctggagttgctgtggacgctcacccgtggcttcaag
gtggtggtgcagggggaggggggctcgctcaaggctcccgcgcgcgccgcgggggcccga
aagcgccccatggacttcagcctcttctacttcgcggatgacgcggaggcgtcgcgtggg
gagagcagctacaagctgctcatggagggcgcgaagttcgcggacacccacggcttcgcg
gcggtgtggacgccggagcgccacttccacgccttcggtggcctgtaccccaacccctcg
gtggcgggcgcggccgtggccgccgtcacgaagcgggtggccatccgcgccggcagcgtg
gtgctgccgctccaccacccggtgcgcgtggcggaggagtggtccctggtggacaacctg
tccggcgggcgcgtgggcatctccgtggcgtccggctggcacgccaacgacttcgtcttc
gcgccggagaagtacgagaagcgccgcgagctgatgatggagggcatcgacaccgtgcgc
cggctgtggcgcggggagacggtgcgcttcccgggcggaggtggcgcccaggtggacgtg
aagctgcgtccccggccggtgcaggcggagctgcccgtgtggctcaccgccgcgggcaac
ccggagacgttcatcaccgcgggccgcatggggtgcaacatcctcacgcacctgctgggg
cagacgtgggaggacctggagaagaagctgggcctctaccgtcaggcctggcgcgacgcg
ggccacgcgggcgagggccacgtcaccctcatgctgcacaccttcatcggcgaagacgct
gcgaaggtgcgcgaggtggtggagcagcccttccgcaactacctcaagagctccgcggac
ctcatgcgcggcctggggagcacgctgggcatcgacatgaactcggccacggaggcggac
ctggaccggctggccggtcacgccttcgaccgctacttcgagacgagcggcctgttcggc
acgccccgctcggtgcgcgagcggattggccagctccaggagctgggcgtggacgaggtg
ggttgcctcatcgacttcggcatccccgccgacacggtgctcgccagcctgccgctgctg
gacgaggtgcggcagcgctgcgtgcgtgacagccgccgcgcgggcactgcgaagtccatc
cccgagcagctccgggagcatggcgtgacgcacttgcagtgcacgccgtccctggcgcgc
gcgctgctggccgagcccgagtccgccgaggccctgggcaacctgcgccgcttgatggtg
ggcggcgaggccctgccgggggcgctggccgcgtcgctgcggcaggcgctgccggcgtcc
gccgaactgctcaacatgtacggccccacggagacgaccatctggtcctccaccgcgcgc
gtggcggcggaggagacggcggccgtcgtctccatcggcacgccgctcctgcgcacgcgc
ttctacgtcctggacgcgctgctgcggccggcgcccgtgggcgtggcgggggagctctac
atcggcggctcgggcgtggtgcgcggctacctggggcgcccggagttgacggcggagcgc
ttcatcccggatgcctggtccaacgagcccggggcgcggctgtaccgcacgggcgaccgc
gcccggtggcgggccgacggcaccatggagttcctgggccgcgtggactaccagctcaag
gtgcgtgggttccgcatcgaggcgggcgaaatcgaggcggcgctcaccgcgcagcccgcg
gtgcgagagtcggtggtggtggcgcgtgaggacgtgcccggcgacgtgcggctcgtggcc
tacgtggtgccccagtcgggcgcggcggtggacgtggccgcgctccgcgacgccctggcg
cagcggctgcccgagcacatggttccatcgctcgtggtggagctgcccgcgctgccgctg
acccccaacgggaaggtggaccgcaaggcgctgcccgcgccgaacgtggtgcgctccgcg
aaggcggccttcgtggcgccccagggacagctcgaggagcagattgcccaggtgtggcgc
tccgtcctgcgcgtggagcaggtgggcgtgcacgacaacttcttcgacctggggggccac
tcgctgctgatggtgcaggtgcacgcgcagctcaagtcggtgctgggacaggacctgccc
ctgctgaagctgctggagcaccccaccatcagcaccctggcccgattcgcgcggcaggac
gccggggccggacagtcccaggtcgaggccgcgcaggaccgggccaagcgccagttggag
agcctcaagcgccagcgccagcgcgcccggaagtaa

DBGET integrated database retrieval system