KEGG   Myxococcus macrosporus: MYMAC_004471Help
Entry
MYMAC_004471      CDS       T05096                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00620  Pyruvate metabolism
mmas00680  Methane metabolism
mmas01100  Metabolic pathways
mmas01120  Microbial metabolism in diverse environments
mmas01200  Carbon metabolism
Module
mmas_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYMAC_004471
  09102 Energy metabolism
   00680 Methane metabolism
    MYMAC_004471
Enzymes [BR:mmas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MYMAC_004471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ATB48840
UniProt: A0A250JYX7
LinkDB All DBs
Position
complement(5640349..5643018)
Genome map
AA seq 889 aa AA seqDB search
MARLRAVDQPLRRDVRLLGRLLGEVLVEQEGQALFDLEEEVRRLAIQRRRGPMAGRRAVA
AELAEVLQRLPLAQAEPVLRAFSVYFQLVNLAEQHHRIRRARTHAEAASARPQRGSLEST
LLALKAAGVPAQRVREAMKAMRVTLTLTAHPTQAVRRTLLEKLYRMAGLLEQRDRSALTP
REGALNLALLREEITLLWQTDELRRERPTVGDEVKNVLWYVEEVLADELSLLPELLDWAF
ERAYGEPLGPVDTPVRIHSWVGGDMDGNPLVTPDVFADTLRAHRARGLRRLLLDLERLGG
RLSQSERHAKPSEELLASVARDAEALPEAERRYGPRTPGEPLRHKLRFMEERLHRALHYV
TQQRAGARIPMPPGAYRTPEALLADLDVLGRALEASKGAHAGLRDVRQVRERVLALGLSL
AELEVRAPAEDAVSAAGSFNGGPAPTEGGARLLEVLARLKEAQSESGEPACRTLILSMAS
TAEDVLAAFRCLQHAGLWDEARGCATVDVVPLFEQLGALDSGPDVLRTLFADAAYRKHLD
ARGGQEVMVGYSDSGKEVGLLAASAALYRAQVALTEVSREAGVPLRLFHGRGESVARGGG
PAQEAILALPPGAVAGGYKATEQGEALDHKYARPELARRTLELILGGVLLHTLDAQPRPA
PEAERTFRTAFDTLAETGRKAYRALVWEDPRFLEFFTAATPVEEIASLPIGSRPSKRKAG
GLETLRAIPWVFAWTQNRAILPGWYGVGSALEAFSKEEGGAALLKRMYREWPFFRAVIDN
VTMVLAKSDMAIAGRYATLAPAATRSLWRRIQQEHRRTRKQVKRLTGESKLLDNNPQLQR
SISLRNPYVDPMSFLQVELLKRKREGQAEVDRPLLLTLNGIAAGMRNTG
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atggcccgactgcgtgccgtggatcagccgctgcgccgggatgtccgcctgcttggccgg
ctcctgggagaagtcctcgtcgaacaggaagggcaggcgctcttcgacctggaagaggaa
gtgcgccgcctcgccatccagcgccggcgcggccccatggccggacggcgcgcggtggcg
gccgagctggcggaggtgctccagcgcctgcccctggcgcaggccgagccggtgctgcgc
gccttctccgtctacttccagttggtgaacctggcggagcagcaccaccgcatccgccgc
gcccgcacccacgcggaggccgcgtccgccagaccccagcgcggctcattggagtccacg
ctgctggcgctcaaggcggccggcgtccccgcgcagcgcgtgcgcgaggccatgaaggcg
atgcgggtgacgctgacgctcaccgcgcaccccacgcaggccgtgcgccgcacgctgctg
gagaagctctaccgcatggcggggctcctggagcagcgggaccgctccgcgctgacgccg
cgcgagggcgcgctgaacctggcgctgctgcgcgaggagatcaccctcctgtggcagacg
gacgagctgcgccgcgagcgccccaccgtgggcgacgaggtgaagaacgtcctctggtac
gtggaggaggtgctcgccgacgagctgtccctgctgcccgagctgctggactgggccttc
gagcgcgcctacggcgagccgctgggcccggtggacacgcccgtgcgcatccattcgtgg
gtgggcggcgacatggacggcaacccgctggtgacgcccgacgtgttcgcggacacgttg
cgcgcgcaccgcgcccgcgggctgcggcggctgctgctggatttggagcgcctgggcggg
cggctgtcccagtcggagcgtcacgcgaagccgtccgaggagctgctggcgtccgtggcc
cgggacgccgaggcgctgcccgaggccgagcgccgctacggcccccgcacgccgggcgag
ccgctgcggcacaagctgcgcttcatggaggagcggctgcaccgcgcgctccactacgtg
acgcagcagcgcgccggggcgcgcatccccatgccgccgggcgcctaccgaacgcccgag
gcgctgctggcggacctggacgtgctgggccgcgcgctggaggcgtccaagggcgcgcac
gcgggcctgcgcgacgtgcggcaggtccgggagcgggtgctggcgctgggcctgtcgctg
gcggagctggaggtgcgcgcgcccgcggaggacgcggtgagcgcggcgggctcgttcaac
gggggcccggcgcccacggagggcggcgcgcggctgctggaggtgctggcgcggctcaag
gaggcgcagtcggagtccggtgagccggcctgccgcacgctcatcctcagcatggccagc
accgcggaggacgtgctcgcggccttccggtgcctccagcacgcgggcctgtgggacgag
gcgcgcggctgcgccacggtggacgtggtgccgctgttcgagcagctcggcgcgctggac
tcgggcccggacgtgctgcgcacgctcttcgcggacgcggcgtaccgcaagcacctggac
gcgcgcgggggccaggaagtcatggtgggctacagcgactccggcaaggaggtgggcttg
ctggcggccagcgcggcgctgtaccgcgcgcaggtggcgctcacggaggtgtcccgcgag
gcgggcgtcccgctgcgcctgttccacggccgcggcgagtccgtggcgcgcggcggcggg
cccgcgcaggaggccattctcgcgctgccgcccggcgcggtggcgggcggctacaaggcg
acggagcagggcgaggcgctggaccacaagtacgcgcgcccggagctggcgcggcgcacg
ctggagctcatcctgggcggcgtgctgctgcacacgctggacgcgcagccccgcccggcg
cccgaggccgagcgcaccttccgcaccgcgttcgacacgctggcggagacggggcgcaag
gcgtaccgcgccctggtgtgggaggacccgcggttcctggagttcttcaccgccgcgacg
ccggtggaggagattgcgtcgctgcccatcggctcgcgtcccagcaagcgcaaggcggga
ggcctggagacgctgcgcgcgattccgtgggtcttcgcctggacgcagaaccgcgccatc
ctcccgggctggtacggggtgggctcggcgctggaggccttctcgaaggaggagggtggg
gcggcgctgctcaagcggatgtaccgggagtggcccttcttccgcgccgtcatcgacaac
gtcaccatggtgctggccaagtcggacatggccatcgccgggcgctacgcgacgctggcg
cccgccgccacccgttcgctgtggcggcgcatccagcaggagcaccggcgcacgcgcaag
caggtgaagcggctgacgggggagtccaagctgctcgacaacaacccgcagctccagcgc
agcatttccctgcgcaacccctacgtggaccccatgtccttcctccaggtggagctgctc
aagcgcaagcgcgagggccaggcggaggtggatcgtccactgttgctcacgctcaacggc
atcgccgccggcatgcgcaacaccgggtag

DBGET integrated database retrieval system