KEGG   Myxococcus macrosporus: MYMAC_005909Help
Entry
MYMAC_005909      CDS       T05096                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mmas  Myxococcus macrosporus
Pathway
mmas00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mmas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MYMAC_005909
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmas02000]
    MYMAC_005909
Enzymes [BR:mmas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MYMAC_005909
Transporters [BR:mmas02000]
 Other Transporters
  Pores ion channels [TC:1]
   MYMAC_005909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_2 GST_N_3 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ATB50254
UniProt: A0A250K2E7
LinkDB All DBs
Position
7376223..7376831
Genome map
AA seq 202 aa AA seqDB search
MKLFYSPGACSLSPHIILREGGFAFTTEKVDIRAKKTAAGEDFLGINAKGYVPALQLDDG
SLLTEGPAIVQYLADQVPDKKLAPANGTLARYRLQEMLNFISTEIHKGFSPLFNPAFPEE
GKRLTKERLALRLGVLEAVVAKQAFLMGEQFTVADAYLFTTLNWAGHTKVDLEPFPALRA
YHARVADRPSVQEALKAEGLAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttctactctcctggtgcctgttcgctgtcgccccacatcatccttcgcgag
ggcggcttcgccttcaccaccgagaaggtggacatccgcgccaagaagacggcggcgggc
gaggacttcctcggcatcaacgccaagggctatgtcccggcgctgcagctcgatgacggc
agcctgctgacggagggccccgccatcgtccagtacctggccgaccaggtccccgacaag
aagctggccccggccaacggcacgctggcgcgctaccgcctccaggagatgctcaacttc
atctccaccgaaatccacaagggcttcagcccgctcttcaacccggccttcccggaggaa
ggcaagcggctgacgaaggagcggctcgcgctgcgcctgggcgtgctggaggcggtggtg
gcgaagcaggcgttcctgatgggtgagcagttcaccgtggcggacgcgtacctcttcacc
acgctcaactgggccggccacacgaaggtggacctggagccgttccccgcgctgcgcgcc
tatcacgcccgcgtggcggaccggccctccgtgcaggaggcgctgaaggccgaaggcctc
gcgaagtga

DBGET integrated database retrieval system