KEGG   Myxococcus macrosporus: MYMAC_006494Help
Entry
MYMAC_006494      CDS       T05096                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
mmas  Myxococcus macrosporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: ATB50837
UniProt: A0A250K504
LinkDB All DBs
Position
8087079..8088134
Genome map
AA seq 351 aa AA seqDB search
MRANVFRGVNRFGIEEVERPRAGAGEAIIRMTLTTVCGTDLHIVRGEYPVRAGLVIGHEP
VGVIEELGPGVTDYRPGQRVLVGAITPCGQCRACLSGHLSQCGHGAGWEALGGWRMGNTQ
DGAQAEYIRIPSAQANLAPIPDELTDEQVVLLSDIASTGFSGAESGGVRIGDAVVVFAQG
PIGLCASIGARLMGASLVVGVDGDESRLKMAQRMGVDVVLDYRQQDIVAEVKRLTGGGAD
VAIEALGTQQTFESALRCLRPAGTLSSLGVYAGKLQLPYDAFSAGLGDHRVVTTLCPGGK
ERMRRLMDVVLRKRVDLSPLITHRFKLADIQEAYALFGERRDGVFKVAIQP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcgagccaatgtctttcggggggtgaatcgctttggcatcgaagaggtggagcgccct
cgggcgggcgccggagaagccatcatccggatgacgctgaccaccgtctgcggcacggac
ctgcacatcgtccgcggcgagtatccggtgcgcgccgggctcgtcatcggccatgagccg
gtgggcgtcatcgaggaactgggtcctggcgtgacggactaccggcccggccagcgcgtc
ctcgtgggcgccatcaccccgtgcggacaatgcagggcctgtctgtccggtcacctgtcg
cagtgcggccacggcgcgggctgggaggccctgggaggctggcgcatgggcaacacccag
gatggcgctcaggccgaatacatccgcatcccctccgcgcaggccaacctggcgcccatt
ccggatgagctcacggacgagcaggtcgtcctcctgtcggacatcgcttccacgggcttc
agcggcgcggagtcgggcggtgtgcgcatcggtgatgccgtggtcgtcttcgcccagggc
cccatcggcctgtgtgcctccattggcgcgcggctgatgggcgcgtcgctcgtggtgggc
gtggatggcgatgagtcccggctgaagatggcccagcggatgggcgtggacgtggtgctc
gactaccggcagcaggacatcgtggcggaggtgaagcgcctcaccggtggcggcgccgac
gtggccatcgaagccctgggcacccagcagaccttcgaatccgcgctgcgctgcctgcgg
cccgcgggcacgctgtccagcctgggggtgtacgctggcaagctccagctcccctacgac
gccttctccgccggcctgggggaccaccgcgtcgtcaccaccctgtgcccgggaggcaag
gagcgcatgcgccgcctcatggacgtggtgcttcgcaagcgcgtcgacctgtcgccgctc
atcacccaccgcttcaagctcgcggacatccaggaggcctacgcgctcttcggcgagcgc
cgcgacggcgtcttcaaggtcgccatccagccctga

DBGET integrated database retrieval system