KEGG   Methanosarcina mazei Tuc01: MmTuc01_1292Help
Entry
MmTuc01_1292      CDS       T02477                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00630  Glyoxylate and dicarboxylate metabolism
mmaz01100  Metabolic pathways
mmaz01120  Microbial metabolism in diverse environments
mmaz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MmTuc01_1292
Enzymes [BR:mmaz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MmTuc01_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AGF96675
UniProt: M1Q321
LinkDB All DBs
Position
complement(1263561..1264847)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDIGYSPKETDLVCEFHIEPTAGVNFEEAATHLAGESSIDSWTEIATLSPELAEK
LKPHVFYADEGAQTIRVAYSEELFELGSVPQVLSAVAGNILSMKIVDNVRLQDIAFPKSM
INEFKGPNFGLPGIRKLVGVQDRPLIGTIVKPKVGLNSEKHAEVAYNSFVGGCDLVKDDE
NLSDQKFNSFEKRAELTLKLAEKAESETGEKKMYLCNVTAPTCREMIRRMNFLKDLGASY
VMVDIVPAGWTAIQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLNLRDQCVLDKVPADESQHILAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTVAGATACRQALEASLEGISLQDYAKNHKELET
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagaagggactatattgacatcggctacagcccgaaagagacggatctggtctgtgaa
ttccacattgaaccaacagcaggagtgaattttgaagaagctgccacccatctggcaggg
gaaagttccatagattcctggactgagattgctacgctgagtcctgaacttgcagagaaa
ctgaaaccccatgtcttttatgcggatgagggtgcacagactataagggttgcttattcg
gaagagctttttgagctgggttctgtccctcaggtcctcagtgctgttgcagggaatatc
ctgagcatgaaaatagttgataacgtaaggctgcaggatatcgctttcccgaaatcaatg
attaatgaattcaaaggccctaacttcggactgccggggatcagaaaacttgtgggcgta
caggacaggcctctcatagggactattgttaaaccgaaagtcggcctgaactctgaaaag
cacgctgaggtcgcttacaattcttttgtcgggggctgcgaccttgttaaggacgatgaa
aatctgagtgatcagaaatttaacagttttgagaagagagccgagcttaccctgaaactt
gcagaaaaggcagagtctgagacaggggaaaagaagatgtacctctgcaatgtcactgcc
cccacctgcagggaaatgatccgccgcatgaacttccttaaagaccttggagccagttat
gtaatggttgacatcgtgcccgctggctggactgcgattcaaaccctgcgcgaggaagct
gaggatgcgggtcttgcccttcacgcccaccgctgcatgcattccgcctacacacgaaac
ccgcgccatgggataagcatgcttgttgttgccaagctgtgcaggctgataggccttgac
cagctccacataggcactgttgtcgggaaaatgcatggagaaaagcatgaagtccttaac
ctcagggaccagtgcgtgctcgataaagtgcctgccgacgaaagccagcatatccttgcc
caggactgggggggattaaagccaatgttccctgtagcatccggaggtctcgctcctaca
atgatccctgacctttattctatctttggaaaagacgttattatgcagttcggaggcgga
attcacgctcacccaatgggcacagtagccggagccactgcgtgcaggcaggctctcgaa
gcaagccttgaaggaatcagcctccaggactatgcgaaaaatcataaagaacttgaaacc
gctcttggaaaatggttgaagaaataa

DBGET integrated database retrieval system