KEGG   Methanosarcina mazei Tuc01: MmTuc01_1500
Entry
MmTuc01_1500      CDS       T02477                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mmaz  Methanosarcina mazei Tuc01
Pathway
mmaz00300  Lysine biosynthesis
mmaz01100  Metabolic pathways
mmaz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmaz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MmTuc01_1500
Enzymes [BR:mmaz01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MmTuc01_1500
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AGF96869
UniProt: M1QIS9
LinkDB
Position
complement(1486639..1487433)
AA seq 264 aa
MALLTPEDLENINKQLQEADSTVRRVTGLDIKGICKDFYGTTPCCEKVGIVPVTSGNGII
GSFSESLNAIAGYFGFDSFITDMPDVSGYYEAVKNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKEVLAVGLGKVGFPGAAHLVQKGFKVYGYDADRTLLEKS
VSSLGIIPFNPVSPEGDRQRKFSIIFEATPCADTIPESVISENCVISTPGIPCAISKELQ
KKCGVELVMEPLGIGTASMLYSVL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaatattaacaaacagcttcaagaagctgat
tctactgtccgcagagttacagggcttgatataaaaggtatctgtaaagatttctacggc
acaaccccatgctgtgaaaaagtaggtatcgtgcctgtgacctcagggaacgggatcata
gggagcttttccgaatccctgaatgcaattgccgggtatttcgggtttgacagttttatt
actgatatgcctgacgtcagcggatattatgaggcagtaaagaacggagcccggatcata
cttatggcagatgataataccttccttgcccacaacctgaaaaatggaaaaatcgccaat
aaccagccgtgtacaggcataatttatgctgaaatagcttcaagatacctgaaagccgat
tccaaagaagtgcttgccgtgggtcttgggaaggttggatttccgggagcagcccatctc
gtacagaaaggcttcaaggtttacggatatgatgctgacagaacccttctagaaaaaagc
gtttccagcctcggaattatacctttcaatcccgtcagccccgaaggcgacaggcaaagg
aagttttccattattttcgaagcaaccccctgtgcagacacgattccggaatccgtaatt
tcggaaaactgtgtgatttctacccctgggataccctgtgcaatctcaaaggagctgcaa
aaaaagtgtggagttgaacttgtaatggaaccactggggataggtacagcatcaatgctg
tattctgtactctaa

DBGET integrated database retrieval system