KEGG   Methylotenera mobilis: Mmol_2171Help
Entry
Mmol_2171         CDS       T00942                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00730  Thiamine metabolism
mmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Mmol_2171
Enzymes [BR:mmb01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     Mmol_2171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like Pyr_redox Pyr_redox_2 Trp_halogenase FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_9 ApbA FAD_oxidored GIDA NAD_binding_7 UDPG_MGDP_dh_N 3HCDH_N AlaDh_PNT_C TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACT49073
UniProt: C6WT11
LinkDB All DBs
Position
2348399..2349484
Genome map
AA seq 361 aa AA seqDB search
MAKPHTMIIGGGIVGCMTAMELIHKGHRVTIVERNQIASQTSGESSWAGGGIIFPLLPWQ
YSEPVNALTKHSADFYRTLSQQLAQETGLPTDFVQSGFLLLPKFDIDAAQSWCVRNEVSV
QPVKASAFGVQSSEGENALWLPTVCQIRPPYLMQALRKWLEQHQVTMLEHTQLLPLEETQ
QLNEWQTTSGEKLSADQFVVTSGAWSFDLLKATSAKLNIKPMRGQILLYQPQQNLEQMVY
KEGFYMIPRLDGYLLAGSTLEDVGFDNGVTEAVREELRMKAEAIMPELKGQAIIKHWSGL
RPGTPENLPTIGAHPTIKNLYLNTGHFRYGLTMAPASAKLIAAIISGESPTLDASPYACA
H
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccacacaccatgatcataggcggcggcattgtaggctgcatgaccgcaatg
gagttaattcacaaaggccaccgcgttaccattgtggaacgcaatcaaatcgccagtcaa
acctcaggcgaatcatcctgggctggcggcggcattattttcccgctgctgccatggcaa
tactccgagccggttaatgccttgaccaagcacagcgctgacttctatcgcacactatct
cagcagctagcgcaagaaactggcctgccgactgattttgtacagtcaggctttttacta
ctgccaaaatttgatatcgacgctgcacaaagctggtgtgtgcgcaacgaagtcagcgtg
caaccggtcaaagccagcgcttttggcgtgcagtctagcgaaggtgaaaatgcgctgtgg
ctgcccaccgtgtgccaaatacgcccaccgtatttaatgcaggctctgcgcaaatggctg
gagcaacaccaggtcaccatgctggagcacacacagttgctgccactggaagaaacgcag
cagctcaatgagtggcaaaccacgagtggagagaaactaagcgccgatcaatttgtggtc
acttcaggcgcttggagctttgacctattaaaagccaccagcgccaaactgaatatcaag
ccgatgcgtgggcagattctgctctaccagccacaacagaatcttgagcaaatggtctac
aaagaaggtttttatatgattcctcgcctagatggctacctgctagcaggcagcacgctg
gaagatgtaggatttgataatggcgtaactgaagcggtgcgtgaagagctgcgcatgaaa
gcagaggcaattatgcccgagctaaaagggcaagctattattaaacactggagcggattg
cgccctggcacccctgaaaacctgccaaccattggtgcacaccctacaatcaaaaatctg
tacttaaatacaggtcacttcaggtatggactcaccatggcccccgccagcgccaaacta
atcgcagccattatctctggagagtcgcccacactagatgcctcaccttatgcctgtgcg
cattag

DBGET integrated database retrieval system