KEGG   Methylotenera mobilis: Mmol_2250Help
Entry
Mmol_2250         CDS       T00942                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mmb  Methylotenera mobilis
Pathway
mmb00970  Aminoacyl-tRNA biosynthesis
mmb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mmol_2250
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmb03029]
    Mmol_2250
Enzymes [BR:mmb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mmol_2250
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mmol_2250
Mitochondrial biogenesis [BR:mmb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mmol_2250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ACT49152
UniProt: C6WT90
LinkDB All DBs
Position
complement(2433446..2434894)
Genome map
AA seq 482 aa AA seqDB search
MEWEVVIGLETHTQLKTNTKIFSGASTTYGAEPNTQACEVSIALPGVLPVLNKEAVNCAI
KFGLAIHADIAPRSVFARKNYFYPDLPKGYQISQYELPVVGKGAVTIQVPAVGKNAAYEK
AINITRAHLEEDAGKSVHGAVEGMSGIDLNRAGTPLLEIVTEPDMRSAAEAVAYAKKLHE
LVQWIGICDGNMQEGSFRCDVNVSVRPKGTEKLGTRREIKNLNSFKFMQQAIEYETRWQI
ETLEDGGTIQQATVLFNPDTGETRAMRSKEEANDYRYFPDPDLLPLEITEADKARIQAEM
PELPEAMKARFESQFGLTSYDAATLTADRALADYFVAVVNAGAEAKPAANWVMGAISAKL
NAEEKSLAASPVGAESLAALIKRITDNTISNNAAKQVFEAMWNGEGEVDAIIEAKGLKQV
SDTGAIEAIIDEVLAANAAMVEEFKAGKEKAFNALVGQAMKASKGKANPAQVNEVLKRKL
GA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaatgggaagtcgttattgggttagaaacacatacccagttaaaaacaaatactaaa
attttctcaggtgcttccaccacttatggcgccgagcctaacacacaggcgtgtgaagtg
agcattgccttgcctggtgtgttgccagtattgaataaagaagcagtgaattgtgcgatt
aagttcggtctggcaatacatgctgacatcgcaccgcgttctgtatttgcgcgtaaaaac
tacttctacccggatttacctaaaggttaccaaatcagccagtatgagttaccggtggtg
ggtaaaggcgcggtcaccatacaagtgccggcagtaggcaaaaacgctgcttatgaaaag
gcaattaatatcacgcgtgcacatttggaagaagatgcgggtaaatctgtgcatggcgcg
gtagagggcatgagcggtatcgacttaaaccgtgctggtacacctttgctggaaattgtg
accgagcctgatatgcgctcggcagcagaagcggtagcttatgccaaaaaactgcatgag
ttggtgcaatggataggtatttgcgacggcaatatgcaggaaggcagcttcagatgcgat
gtgaacgtttctgtgcgcccaaaaggcactgaaaagttgggcacgcgccgtgaaattaaa
aatctgaactcattcaagttcatgcagcaggcgattgagtatgaaacgcgctggcagatt
gaaacgctggaagatggcggcaccattcagcaggctactgtactgtttaacccggatacc
ggtgaaacgcgcgccatgcgtagcaaagaagaagcgaatgactatcgctacttcccggat
cctgatttattaccattagaaattaccgaagcagataaggcacgcatacaggcagaaatg
ccagagctgccagaggcgatgaaggccagatttgaaagtcagtttggcttaactagctac
gatgcggctacactcacggcagaccgcgcactagcggattacttcgtggcggtagtgaat
gccggtgccgaagccaaaccagccgctaactgggtgatgggtgcgatttctgctaagttg
aatgcagaagaaaaatccttggcagcatcacctgtgggtgcggagagcttggcggcgctg
attaaacgcatcacggataacactatttctaataacgcggctaaacaagtgtttgaagcc
atgtggaatggtgagggtgaagtggatgccattatcgaagccaaaggcctcaagcaagtt
tcggatactggtgcgattgaggccattatcgacgaagtgttagcggccaatgcggctatg
gtagaagagttcaaggcaggcaaagaaaaggcatttaatgctttagtcggccaagcgatg
aaggcttctaaaggcaaagccaacccggcacaggtaaatgaggtattgaagcgcaagcta
ggtgcttag

DBGET integrated database retrieval system