KEGG   Mycobacterium sp. MCS: Mmcs_1373
Entry
Mmcs_1373         CDS       T00367                                 

Definition
(GenBank) benzoate 1,2-dioxygenase, alpha subunit
  KO
K05549  benzoate/toluate 1,2-dioxygenase subunit alpha [EC:1.14.12.10 1.14.12.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00362  Benzoate degradation
mmc00364  Fluorobenzoate degradation
mmc00622  Xylene degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mmcs_1373
   00364 Fluorobenzoate degradation
    Mmcs_1373
   00622 Xylene degradation
    Mmcs_1373
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.10  benzoate 1,2-dioxygenase
     Mmcs_1373
    1.14.12.-  
     Mmcs_1373
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: ABG07485
UniProt: A0A5Q5BGT6
LinkDB
Position
complement(1490156..1491544)
AA seq 462 aa
MEAPMSAPTAEPRSHLETVLADAVIDDHAAGIYRTNRRIFTDEDIFELEMEHIFEGNWIY
LAHESQVAEPGDYFTTYMGRQPVVITRDKNGGLNCLVNACAHRGAMVCRRKTDNRMTLTC
PFHGWTFRNDGTLLKVKDPEGAGYPATFDVDGSHNMTKVARFDSYRGFLFGSLNPDVVPL
LEHLGDTTKVIDMLVDQSPDGLEVLRGSSTYTYDGNWKVQAENGADGYHVTATHWNYAAT
TSRRNTGESANDTKALDAGSWGKSGGGYWSYPNGHLCLWTWAANPEDRPLWDRLDDLKSV
HGAAKGEFMVKGSRNLCLYPNVYLMDQFSTQIRHFRPIAPDKTEVTIYCIAPKGENADAR
ARRIRQYEDFFNASGMATPDDLEEFRSCQLTYQATAAPWNDMSRGAQHWLSGPDEVAESL
GMHGVISAGVRNEDEGLYPVQHGYWLQTMRAALAQNETGSEK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggaggcaccgatgagcgcaccgacagccgaaccccgcagtcacctcgagaccgtcctc
gccgatgcggtgatcgacgaccacgcggccgggatctaccgcaccaaccggcggatcttc
accgacgaggacatcttcgagctcgagatggagcacatcttcgagggcaactggatctac
ctcgcccacgaaagtcaggtcgccgaaccgggcgactacttcaccacgtacatgggccgc
cagcccgtcgtcatcacccgcgacaagaacgggggcctcaactgcctggtcaatgcctgt
gcacaccgaggggcgatggtgtgccgacgcaagaccgacaaccggatgacgctcacctgt
ccctttcacgggtggaccttccgcaacgacgggaccttgctcaaggtcaaggatcccgag
ggggccggctacccggcgacgttcgacgtcgacggctcgcacaacatgaccaaggtggcc
cggttcgacagctaccgcggattcctgttcggcagcctcaacccggacgtcgtccccctc
ctcgagcacctcggtgacaccaccaaggtcatcgacatgctcgtcgaccagtcccccgac
ggcctggaggtgttgcgcggatcgtcgacctacacctacgacggcaactggaaagtgcag
gcggagaacggcgccgacggttatcacgtcaccgcgacgcactggaactacgccgcgacc
acctcacggcgcaacaccggcgagtccgccaacgacaccaaggcgctcgacgccggcagc
tgggggaagtccggcggcggctactggtcctacccgaacggccacctctgcctgtggacg
tgggcggccaaccccgaggaccgcccgctgtgggaccggctcgacgacctcaagagcgtc
cacggcgcggccaagggcgagttcatggtgaagggttcacgcaacctgtgcctgtacccg
aatgtgtatctgatggaccaattctcgacgcagatccgccacttccggccgatcgcgccg
gacaagaccgaggtcaccatctactgcatcgcccccaagggtgagaacgccgatgcccgc
gccaggcgcatccgccagtacgaggacttcttcaacgcctcgggcatggccaccccggac
gacctcgaggagttccgctcctgccagctgacctaccaggccaccgccgccccgtggaac
gacatgagccgcggtgcgcagcactggctgtccggacccgacgaggtcgccgaatcgctg
gggatgcacggcgtcatctccgcgggcgtgcgcaacgaggacgagggcctctaccccgtc
cagcacggctactggctgcagaccatgcgtgcggcgctggcccaaaacgagaccggatcg
gagaagtga

DBGET integrated database retrieval system