KEGG   Mycobacterium sp. MCS: Mmcs_1622
Entry
Mmcs_1622         CDS       T00367                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, alpha subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00624  Polycyclic aromatic hydrocarbon degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Module
mmc_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mmcs_1622
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mmcs_1622
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: ABG07733
UniProt: A0A5Q5BHI0
LinkDB
Position
1758941..1760395
AA seq 484 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEIRVMFNMCLHRGMQVCRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVRGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKANKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPADMISRAKATWTEQQQQVVGTDGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPADFKADSYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDARVVDTLSSAQFHGPGYAQ
LGYNENNQRELLRLWADYLDMPPLRVDPATVLTDNPQGIEPMVQTNGGAVAGIDSESATT
SVTL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttagcggctgtacgcactggcatgatcccggcgcacgtg
tataacgacaagcaaattttctcgctcgagaaggagcgcctgttcagtcgggcgtggttg
ttcgtggcgcacgagtcggagattccgcagccgggggactacgtggtcagacaagtgttg
caggattcgttcatcgtcgctcgtgattctgccggcgagatccgggtgatgttcaatatg
tgcctccatcgcggtatgcaggtttgccgggcggaaatggggaacgcgtcgaacttcaga
tgcccgtaccacgggtggtcttaccgcaatgacggtcgcattattggcctgccgtttcac
caagaggcttacggaggagacgccgggtttaacaagacggggcagaccttgttgcccgcg
ccgagtgtggccagctacaacgggttgatctttctgtcgatggatcctgacgcagaatcg
cttgaagactatctgggtgatttcaggttctatctcgatttctacaccaagcaaggcccc
aacggtcttgaggtgcgaggtccgcagcgttggcgggtaaaagcgaactggaagatcgca
gctgaaaatttcgccggggacatgtaccacacacctcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggctaacaagcgcaaagacggcgccacgtattgggcg
ggtagaggtgggggcaccacatacaagctgcccgaggggagtttcgaggaccggatgagc
tacgtgggctacccggcggacatgattagtcgagccaaggccacctggaccgagcagcag
caacaagtcgtcggcaccgacgggttcatgatctcggccgcgacgtgttttcccaacatc
agtttcgtgcacaactggccgaaagtggaggacggggagcacgtcttgccgttcatttca
atccgggtgtggcagccaatcagcgagaacgaaaccgaggtgctgtcgtggtttgcggtg
gattctgatgccccggcagactttaaggcggactcgtataaggcttatttgatgtgcttc
ggctcgacgggaatgttcgagcaagacgatgtcgagaactgggtgtcgctgaccaacacc
gcggggggttccatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgcccgggtggtcgacaccctaagcagcgctcaattccacgggcctggatacgctcag
ctcggctacaacgagaacaatcaacgggaattgttgaggctctgggccgactacctcgac
atgccgccgctgcgagtcgacccggctactgtgctcacggacaacccgcaaggtattgag
ccgatggtgcagaccaacggcggggccgtcgccggtatcgactcggagtcggctacgacg
tcggtgacgctgtga

DBGET integrated database retrieval system