KEGG   Mycobacterium sp. MCS: Mmcs_1623
Entry
Mmcs_1623         CDS       T00367                                 

Definition
(GenBank) phthalate 3,4-dioxygenase, beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00624  Polycyclic aromatic hydrocarbon degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Module
mmc_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    Mmcs_1623
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mmcs_1623
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABG07734
UniProt: A0A5Q5BHH3
LinkDB
Position
1760392..1760988
AA seq 198 aa
MTVDDQRTGRPMAPSVLGAHAARAQRVGDPLPFDDSRHLEAHRFLVNEAYLLDAQDYDRW
LGVLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLSRRVARFATEHAWTEDPPSR
LRHFITNVRTFLTDDADHLAVDSAELLFRSRGDVNESTLLSCGREDLLRRDGNALKLARR
TIAVDESVLRMQNLAVFL
NT seq 597 nt   +upstreamnt  +downstreamnt
gtgaccgtcgacgatcaacgcactggtcgacccatggccccatcggtactcggtgcgcac
gccgcgcgcgcccaacgcgtcggcgacccgttaccgttcgacgattctcgccatctggag
gcgcatcgcttcctcgtcaacgaggcgtacctcctcgatgcccaagactacgacaggtgg
ctgggtgttcttaccgaggacattcactattacatgccggtgcggatcaccaccgccgcc
ggcgccggattcgatagctcaccgggaatggcgcatttcgacgagaacaaatactcactc
agtcgccgcgttgcccgattcgccaccgagcatgcctggactgaggatccgccgtcgcgc
ctgcgccacttcatcaccaacgtgcgcacattcctcaccgacgacgccgaccacctcgcg
gtcgacagcgctgagttgttgttccgcagccgcggcgacgtcaatgagtccacgctcctc
tcatgcggtcgtgaagatcttctacgtcgcgatggcaacgccctcaaactcgcccggcgc
acaatcgccgtcgatgaatcagtgcttcgaatgcagaatctggcggtattcctatga

DBGET integrated database retrieval system