KEGG   Mycobacterium sp. MCS: Mmcs_1667
Entry
Mmcs_1667         CDS       T00367                                 

Definition
(GenBank) aromatic-ring-hydroxylating dioxygenase, beta subunit
  KO
K14749  ethylbenzene dioxygenase subunit beta [EC:1.14.12.-]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00642  Ethylbenzene degradation
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
mmc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00642 Ethylbenzene degradation
    Mmcs_1667
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     Mmcs_1667
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: ABG07777
UniProt: A0A5Q5BHR9
LinkDB
Position
1805206..1805748
AA seq 180 aa
MTTTVPQDPPQAARVSRDVREEIEDFLFDEADLLDRDEFEEWLELLAPNVHYFARVRQTL
RRAGGPGFSERSMHLSDNYTSLKMRIQRHRTSSDWAEDPPSRIRHYITNVRVRSGEDGDE
YRVTSNALLVRTRGDEAKAETVSAERRDIIRRDETGLKLVQREILLDHTTLPTHNLSFWI
NT seq 543 nt   +upstreamnt  +downstreamnt
atgacgacaacggtgccgcaggatccacctcaggctgcgagggtttcgcgcgacgtgcgc
gaggaaatcgaagacttccttttcgacgaggccgatctgttggatcgcgatgagttcgaa
gagtggctggaattgctggcaccgaatgtgcactatttcgcgcgcgtccgtcagacgctt
cgcagagcaggtggcccggggttctctgagcgctctatgcacctgagtgataactacacg
agtctgaagatgcgtattcagcggcaccgaacgtcgtcggattgggctgaggatcctccg
tcgcggatccggcactacatcaccaatgtcagggtcaggtctggtgaggacggcgatgag
taccgtgtgacgtcgaatgcgttgctggtgcgcacacgcggggacgaagccaaggcggag
acagtttctgccgagcgccgagacattattcgtcgcgacgagacgggtttgaaactggtc
cagcgcgagatcctgctggatcacaccacgttgcccacgcacaacctgtcattctggatc
taa

DBGET integrated database retrieval system