KEGG   Mycobacterium sp. MCS: Mmcs_2274Help
Entry
Mmcs_2274         CDS       T00367                                 

Definition
(GenBank) aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mmc  Mycobacterium sp. MCS
Pathway
mmc00250  Alanine, aspartate and glutamate metabolism
mmc00280  Valine, leucine and isoleucine degradation
mmc00310  Lysine degradation
mmc00410  beta-Alanine metabolism
mmc00640  Propanoate metabolism
mmc00650  Butanoate metabolism
mmc01100  Metabolic pathways
mmc01120  Microbial metabolism in diverse environments
Module
mmc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mmcs_2274
   00650 Butanoate metabolism
    Mmcs_2274
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mmcs_2274
   00280 Valine, leucine and isoleucine degradation
    Mmcs_2274
   00310 Lysine degradation
    Mmcs_2274
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mmcs_2274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmc01007]
    Mmcs_2274
Enzymes [BR:mmc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mmcs_2274
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mmcs_2274
    2.6.1.48  5-aminovalerate transaminase
     Mmcs_2274
Amino acid related enzymes [BR:mmc01007]
 Aminotransferase (transaminase)
  Class III
   Mmcs_2274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABG08382
LinkDB All DBs
Position
complement(2411447..2412787)
Genome map
AA seq 446 aa AA seqDB search
MSTLEQSRHLATAIPGPKSQQLIDRKAAAVSRGVGTTMPVYAARAQGGIVEDVDGNRLID
LGSGIAVTTIGNAAPRVVEAVAAQAGRFTHTCFMVTPYEGYVAVAEALNRLTPGSGEKRS
ALFNSGSEAVENAVKIARSYTHKSAVVSFDHAYHGRTNLTMALTAKVMPYKHGFGPFAPE
IYRAPLSYPFRDAEFGKELATDGELAARRAIDVMDKQVGADNLAAVIIEPIQGEGGFIVP
AEGFLPTLLDWCRRNDVVFIADEVQTGFARTGRMFACEHEGIEPDLIVTAKGIADGMPLS
AVTGRAEIMDSPHVSGLGGTYGGNPVACAAALATIETIESENLVERAAAIGALMKDRLGR
LQAEDDRIGDVRGRGAMIAVELVKPGTTEPDAALAKALAAGAHTAGVIVLTCGTYGNVLR
FLPPLAISDELLDEGLDVVAGLLRDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccctcgagcagagccgccacctcgccacggccatccccggcccgaagtcgcag
cagctcatcgaccgcaaggccgccgccgtctcacgcggtgtcggcaccacgatgccggtg
tacgcggcgcgcgcccagggcggcatcgtcgaggacgtcgacggtaaccggctgatcgac
ctgggctcgggtatcgcggtcaccacgatcggcaacgcggccccccgcgtcgtggaggcc
gtcgccgcgcaggccgggcggttcacccacacctgtttcatggtcacgccgtacgagggg
tacgtggcggtcgccgaggcgctcaaccggctcacccccggtagcggcgagaaacgctcg
gcgctgttcaactccggttcggaggccgtcgagaacgccgtcaagatcgccaggtcctac
acccacaaatccgcggtggtgtccttcgaccacgcctaccacggtcgcaccaacctgacc
atggcgctgaccgccaaggtgatgccctacaagcacgggttcggaccgttcgcgccggag
atctaccgcgcgccgctctcctaccccttccgcgacgccgaattcggtaaggaactggcg
accgacggcgaactggccgcccgccgggcgatcgatgtgatggacaagcaggtcggcgcc
gacaatctggccgcggtgatcatcgaaccgatccagggcgagggtggtttcatcgtcccg
gcggaaggcttcctgcccaccctgctcgactggtgccgccgcaacgacgtcgtgttcatc
gccgacgaggtgcagaccggattcgcccgcaccgggcggatgttcgcgtgtgagcacgaa
ggcatcgaacccgacctcatcgtgacggccaagggcatcgccgacggtatgccgttgtcc
gcggtgacgggccgcgccgagatcatggactctccgcacgtgtcgggcctcggcggcacc
tacggcggcaacccggtcgcctgcgcggcggcactggccaccatcgagaccatcgaatcc
gagaacctggtcgaacgcgccgcggcgatcggggcgttgatgaaggaccggctgggtcgg
ctgcaggccgaggacgaccgcatcggcgacgtgcgcggacgcggcgccatgatcgcggtg
gagctggtgaaaccgggcaccaccgaaccggacgccgccctggccaaggcgctggccgcc
ggcgcgcacaccgccggggtgatcgtgctgacgtgcggcacgtacggcaacgtgttgcgt
ttcctaccgccgttggccatcagcgacgagttgctcgacgaagggctcgacgtggtggcc
ggtctcctgcgcgacctctga

DBGET integrated database retrieval system