KEGG   Mycobacterium sp. MCS: Mmcs_3718Help
Entry
Mmcs_3718         CDS       T00367                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
mmc  Mycobacterium sp. MCS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABG09824
LinkDB All DBs
Position
3970459..3971946
Genome map
AA seq 495 aa AA seqDB search
MAVRGDELFIGGTWCAPSTDRRIEVISPHTETTVGHVAAAAPADVDRAVGAAREAFDTGG
WPRTSPAGRIDAVRRLAANYERRRSEMAELITSEIGAPISFSQRAQVALPWSMINAFCDL
AQTYPWREARPGRYGSDIQVLREPVGVVGAVVPWNMPQFLIVTKLIPALLAGCTVVVKPA
PESPLNALLLAEVIAESGLPPGVVSVLPGDGSVGEYLVGHRGVDKVSFTGSTAAGRAVAT
ACAADLRRVSLELGGKSAAIVLDDADPVVVAAGVRSASLSNSGQICNALTRVLVPRSRAG
EFTDALAAEVSALVVGDPTDGATQVGPLVARRQQQRVTGYLEQGVRDGARVVTGGTGMPD
GLDRGWYVKPTVFDRADNSMTIAREEIFGPVLTVVAYDNEDEAVAIANDSDYGLAGSVFT
ADTDRGLAVGAAIRTGTFGVNQGYTMDPFAPFGGVKSSGYGRELGREGIDGYVDTKSISV
APKQDLATAAAGKGA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
ttggcagtgcgtggcgacgagttgttcatcggcggcacctggtgtgcaccgagcaccgac
cggcggatcgaggtcatctccccgcacaccgagacgaccgtcggccacgtcgccgccgcc
gcacccgccgacgtcgaccgggccgtgggcgccgcccgggaagcgttcgacaccggcggg
tggccgcggacgtcgccggcaggccggatcgatgcggtgcgccggctcgccgcgaactac
gaacggcgccgctccgagatggccgagctcatcacctccgagatcggcgcgccgatcagc
ttctcgcagcgggcccaggtggcactgccgtggtcgatgatcaacgccttctgcgatctg
gcgcagacgtatccgtggcgagaggcccgccccggtaggtacggctccgacatccaggtg
ctgcgtgagccggtcggcgtcgtcggcgcggtcgtgccgtggaacatgcctcagttcctc
atcgtcaccaagctgatcccggcgctgctggcggggtgcaccgtcgtcgtcaagcccgct
cccgagtcaccgttgaacgctctactgctcgccgaggtcatcgccgagtccggcttgccg
ccgggcgtggtcagcgtgctgcccggcgacgggagcgtcggcgagtacctggtgggccat
cgcggcgtggacaaggtgtcgttcaccgggtcgacggccgcaggccgggccgtcgccacc
gcatgcgcggccgacctgcggcgggtcagcctcgaactggggggcaagtcggcggccatc
gtcctcgacgacgccgatcccgttgtggtcgccgcgggcgtgcggtcggcgagcctgtcc
aacagcggtcagatctgcaatgcgctcacccgcgttctcgtccccaggtcccgcgccggg
gagttcaccgatgcgttggccgcggaggtcagcgcgctggtcgtcggcgaccccaccgac
ggtgccacccaggtcggcccgctcgtggccagacggcaacagcagcgggtcaccggctac
ctcgagcagggtgtgcgggacggcgcgcgggtggtcaccggtggcacgggcatgcccgac
ggactcgaccgcgggtggtacgtcaagcccaccgtcttcgaccgggcggacaactcgatg
acgattgcgcgcgaggagatcttcgggcccgtgctgacggtcgtcgcctacgacaacgag
gacgaggcggttgccatcgccaacgactccgactacggcctggctggatcggtgttcact
gcggacaccgacagagggctggccgtcggcgcggcgatccgcaccggcaccttcggcgtc
aaccagggctacacgatggatccgttcgccccgttcggtggcgtgaagtccagcggctac
gggcgtgagctcggccgagaaggcatcgacgggtacgtcgacaccaagtcgatctccgtt
gcgccgaaacaggatctcgccacggcggccgcgggcaagggagcgtga

DBGET integrated database retrieval system