KEGG   Mycobacterium sp. MCS: Mmcs_4939Help
Entry
Mmcs_4939         CDS       T00367                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
mmc  Mycobacterium sp. MCS
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ABG11043
LinkDB All DBs
Position
5229412..5230473
Genome map
AA seq 353 aa AA seqDB search
MQLPVSPPIAPMLSKAVTDIPLGASYEPKWDGFRSIVFRDGDEVELGSRNERPMTRYFPE
LVEAARAELPARCVIDGEIVIATADGLDFEALQLRLHPAASRVRMLAEKTPASFIAFDLL
ALGDTDYTSRPFVERRAELERVLTGGHTFHVTPATVDVDTARRWFHEFEGAGLDGVIAKP
LDGPYLPDKRVMFKVKHQRTADCVVAGYRLHKSGDDAIGSLLLGLYTDDGELASVGVIGA
FPMARRRALFAELQPLVATFDEHPWNWAAHADPDVVRRYGGGSRWNAGKDLSFVPLRPER
VVEVRYDHMEGRRFRHTAQFNRWRPDRDPRSCTYAQLEQPVTFRLGDIVPGLG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacttcccgtttcacccccgattgcgccgatgctgtcgaaggcggtcacggacatc
ccgctcggcgcgtcctacgaacccaagtgggacgggttccggtcgatcgtgttccgcgat
ggcgacgaggtggaactcggcagccgcaacgagcggccgatgacccggtacttccccgaa
ctcgtcgaggcggcccgcgcggagcttccggcgcggtgtgtgatcgacggcgagatcgtc
atcgccaccgccgacggactggacttcgaggcgctgcagttgcggttgcatccggcggcg
tcgcgggtgcggatgctggccgagaagacgccggcgtcgttcatcgcgttcgacctgctt
gcgctgggcgacaccgactatacgtcgcggccgttcgtcgaacggcgggccgaacttgaa
cgcgtgctcaccggcggccacacattccacgtcacgccggccaccgtcgacgtcgacacg
gcacggcgctggttccacgaattcgagggcgccggcctcgacggggtgatcgccaaaccg
ctcgacggaccgtatctgccggacaagcgggtgatgttcaaggtcaaacaccagcgcacg
gccgactgcgtggtcgccgggtaccggctgcacaaatcgggcgacgacgccatcgggtcg
ctgctgctcggtctgtacaccgacgacggcgagctggcgtcggtgggcgtgatcggggcg
tttccgatggcgcggcggcgggccctgttcgccgagctgcagccgctggtggccaccttc
gacgagcatccgtggaactgggccgcccacgccgatcccgacgtggtgcgccgctacggg
ggcgggtcgcgctggaacgcgggcaaggatctgtcgttcgtgccgttgcggcccgaacgg
gtggtcgaggtgcggtacgaccacatggaggggcggcgattccgccacaccgcccagttc
aaccgctggcgtcccgaccgcgacccgcgctcgtgcacctacgcgcaactcgagcagccg
gtcaccttccgcctcggcgacatcgtgccggggctcggctga

DBGET integrated database retrieval system