KEGG   Mycobacterium sp. MCS: Mmcs_5044Help
Entry
Mmcs_5044         CDS       T00367                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mmc  Mycobacterium sp. MCS
Brite
Enzymes [BR:mmc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Mmcs_5044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ABG11148
LinkDB All DBs
Position
5342806..5343429
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGANDALSKLAEARESGDHSAIF
LNEKNLAFHLGGHVNHTIWWKNLSPNGGDKPTGELAAALDDAFGSFDNFRAQFTAAANGL
QGSGWAVLGYDTLGQRLLTFQLFDQQANVPLGIIPLLQVDMWEHAYYLQYKNVKADYVKA
FWNVVNWEDVQNRFAKATSSASGIIVG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccttgcccgatcttgattacgattacggcgccctcgaaccgcacatc
tcggggcagatcaacgagcttcaccacagcaaacaccacgcgacgtatgtgaagggcgcc
aacgacgcgctgtccaagctggccgaggcgcgggagtccggagaccactccgcgatcttc
ctcaacgagaagaacctcgccttccatttgggtggacacgtcaaccacacgatctggtgg
aagaacctctctcccaacggtggcgacaagccgaccggtgagctggccgccgcgctcgac
gacgcattcggctcgttcgacaacttccgcgcccagttcaccgccgcggccaacgggctg
cagggctccgggtgggcggttctcggatacgacacgctgggccagcggctgctgaccttc
cagctgttcgaccagcaggcaaacgtgccgctgggcatcatcccgctgctgcaggtcgac
atgtgggagcacgcctactacctgcagtacaagaacgtgaaggccgactacgtgaaggcg
ttctggaacgtcgtcaactgggaggacgtgcagaaccggttcgccaaggcaacgagttcg
gccagcggcatcatcgtcggctga

DBGET integrated database retrieval system