KEGG   Methanococcus maripaludis X1: GYY_08400Help
Entry
GYY_08400         CDS       T01584                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mmd  Methanococcus maripaludis X1
Pathway
mmd01100  Metabolic pathways
mmd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GYY_08400
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    GYY_08400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmd01011]
    GYY_08400
Enzymes [BR:mmd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GYY_08400
Peptidoglycan biosynthesis and degradation proteins [BR:mmd01011]
 Precursor biosynthesis
  Racemase
   GYY_08400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C LAGLIDADG_3 HEPN_LA2681
Motif
Other DBs
NCBI-ProteinID: AEK20533
UniProt: G0H2Y6
LinkDB All DBs
Position
complement(1554706..1555827)
Genome map
AA seq 373 aa AA seqDB search
MVSHPIWAEIDLSAIKNNIKEIRRITNPKSQVMAVVKANAYGHGSVEVSKVCLENGADRL
AVARSTEALELRNAGITCPILVFGYVTEEEILKMVENDITLTVYSLEIANSIQKIAEKLG
KHSKIHIKVDTGMSRLGFLPEKSSVETIKKIRELKNIEVEGIYTHFADADNSDKTYTTMQ
FSKFTSFLHDLEENGINIPIKHASNSAAIIDHPETHLNMVRPGIILYGLYPSELVHKERI
NLQPAMSLKVLVTHVKDVPENTKISYGCTFETKKQSKIASLPIGYADGFTRMLKNGNVLI
HGLRVPVVGRICMDQCMIDVSGIENVNVGDVVTVFGKDGNEKISIEEFGNKLGTINYELV
CMVSARVPRIYLH
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggtttcacatccgatatgggcagaaattgacttaagcgcaattaaaaacaatattaaa
gaaataagacgaattacaaaccccaaatcccaggtaatggcagtagtaaaagcaaatgct
tacggacacggctcagtcgaggtttcaaaagtatgccttgaaaacggggccgataggtta
gcagttgcacgttcaacggaagctcttgaacttaggaatgcaggaataacatgtccgata
ctggtatttggatatgttactgaagaagaaattttgaaaatggttgaaaatgatataact
ttaacagtttattcacttgaaatcgcaaattcaatccaaaaaattgctgaaaaattggga
aaacattcaaaaatccatatcaaagtagacaccggaatgagtagacttggatttttgcca
gaaaaatcgtcggtagaaaccataaaaaaaatcagggaacttaaaaacatcgaagttgaa
ggaatttacacgcattttgcagatgcagataattctgataaaacatacaccactatgcaa
ttttctaaatttacgagttttttacacgatctcgaggaaaatggaattaatattccaata
aaacacgcatcaaatagcgctgcaataattgaccacccggaaacacatctcaatatggta
agaccaggaattattctatacgggctttacccttcagaactggtccacaaggaaagaatt
aatttacaacctgcaatgagtttgaaggtacttgtaacgcatgtaaaagacgttccagaa
aatacaaaaataagttatggatgtacctttgaaaccaaaaaacaatcaaaaattgcatca
cttccaatagggtatgctgatggattcacaaggatgttaaaaaatggaaatgtactaatt
catggattgcgggttcctgttgttggcagaatctgcatggatcagtgcatgattgatgtt
tcaggtattgaaaacgtaaacgttggagacgttgtcacagtatttggaaaagacggaaat
gaaaaaatctccattgaagagtttggtaataaattgggaaccataaattacgaacttgtt
tgcatggtatctgcaagagttccaagaatatatttacattaa

DBGET integrated database retrieval system