KEGG   Marinomonas mediterranea: Marme_1761Help
Entry
Marme_1761        CDS       T01449                                 

Definition
(GenBank) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mme  Marinomonas mediterranea
Pathway
mme00970  Aminoacyl-tRNA biosynthesis
mme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Marme_1761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mme03029]
    Marme_1761
Enzymes [BR:mme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Marme_1761
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Marme_1761
Mitochondrial biogenesis [BR:mme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Marme_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ADZ91017
UniProt: F2K0N3
LinkDB All DBs
Position
complement(1953295..1954740)
Genome map
AA seq 481 aa AA seqDB search
MNWEVVIGLEIHAQLATKSKLFSGAATSFGAEPNTNTTLVDLGMPGALPVFNKEALRMAV
MFGHAVDAEIGMTSVFARKNYFYPDLPKGYQTSQMDHPIVGPGHLDVTLEDGTVTRVGIT
RAHLEEDAGKSLHEDFHGMTGIDLNRSSTPLLEIVSEPDIRSAKEAVAYVKMIHSIVTYL
GICDGNMAEGSMRCDVNLSLRPKGQEEFGTRTEIKNVNSFRFIEKAIYCEIERQMDILED
GGKIVQETRLYDPDKDETRSMRSKEDANDYRYFPCPDLLPIVLDDEYVEEIRANLPELPT
QKAKRFEAEYALSEYDAGVLSSSRAMADYFEDAAKTAKNSKLAANWVMGEVSKFLNQENL
DITESPVSAQALGQLLSRIEDNTINGKTAKDVFQSMWQGEGSADEIIEKKGLKQVTDTGA
IETLIQSVIDANPAQVEQFKASEPDKQKKMIGFFMGQVMKASQGKANPGLVTPILNKLLN
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggaagtcgtaatcggcctagagattcatgctcaattggcgacaaaatcgaaa
ctattctctggcgccgcgaccagctttggcgccgagccaaacaccaacacaacactcgtt
gacctaggaatgcctggtgcactaccggtcttcaacaaagaagcattacgcatggcagtt
atgtttggtcatgctgtagacgcagaaatcggcatgacatcggtctttgcacgtaaaaac
tacttctacccagacttgccgaaaggctaccagacaagccaaatggatcatcctattgtc
ggccctggacacctagacgtaacacttgaagacggaacagtaacgcgagtaggcatcaca
cgcgcccacttagaagaagatgcaggaaaatcactacacgaagatttccacggcatgaca
ggtatcgacctcaaccgctcaagcacaccgttactagaaatcgtctcagagccagacatt
agatctgccaaagaagccgtcgcctatgtaaaaatgattcactcaattgttacttacctt
gggatttgtgacggaaacatggcggagggctctatgcgctgcgacgtcaacctttccctt
cgtcccaaaggacaagaagagtttggtacgcgaacggaaatcaaaaatgtaaactcattc
cgtttcattgaaaaagcaatttactgcgaaatcgagcgccaaatggacattctcgaagat
ggcggaaaaatcgtacaagaaacgcgcctctacgatccagataaagacgaaacccgaagc
atgcgaagcaaggaagacgctaacgattatcgctacttcccctgcccagacctactccct
atcgtgcttgacgatgagtatgttgaggaaattagagccaatttacctgagctgcctaca
caaaaagcgaaacgtttcgaagcagaatacgcacttagcgaatacgatgcaggcgtttta
tccagctcacgcgcaatggcagactactttgaagacgcagcgaaaaccgctaaaaactca
aagttggcagccaactgggtaatgggcgaagtgagtaagttccttaaccaggaaaaccta
gacattacagagagcccagtttccgcgcaagcattaggacaactattgagccgtatagaa
gacaacacaatcaacggtaaaacggcgaaagacgtattccaaagcatgtggcaaggcgaa
ggctcagcagatgaaattattgagaaaaaaggccttaaacaagtaacagatactggcgca
atagaaaccctaattcaaagcgttattgatgcaaacccagctcaagtagagcaattcaaa
gcatcagaacctgacaagcagaaaaaaatgatcggtttctttatgggacaagtcatgaaa
gcttctcaaggcaaagccaatcctggactggttaccccaatcctaaataagttactaaac
aactag

DBGET integrated database retrieval system