KEGG   Marinomonas mediterranea: Marme_3696Help
Entry
Marme_3696        CDS       T01449                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Organism
mme  Marinomonas mediterranea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_9 Fer4_16 GF_recep_IV Fer4_21 Fer4_4 Fer4_6 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADZ92906
UniProt: F2JW18
LinkDB All DBs
Position
complement(4077007..4077258)
Genome map
AA seq 83 aa AA seqDB search
MSLIITDECINCDVCEPECPNEAISQGEEIYVIDPAKCTECVGHYDEPQCVQVCPVDCIP
KDKDYVETEEELMEKYLVLTGQL
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgtctctaatcattaccgatgaatgcataaactgcgacgtctgtgagcctgaatgtcca
aatgaggcaatcagtcagggtgaagaaatttatgtaatcgatcctgccaaatgtactgaa
tgtgtaggccattatgatgagccacaatgtgtgcaagtgtgcccagttgattgtatacct
aaagacaaagattacgtcgaaacagaagaagagctcatggaaaagtatttggtattaacg
ggtcagctctaa

DBGET integrated database retrieval system