KEGG   Marinomonas mediterranea: Marme_3760Help
Entry
Marme_3760        CDS       T01449                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mme  Marinomonas mediterranea
Brite
KEGG Orthology (KO) [BR:mme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Marme_3760
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Marme_3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO Glutaredoxin FAD_binding_3 NAD_binding_8 Thi4 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADZ92970
UniProt: F2JWV3
LinkDB All DBs
Position
4146014..4147558
Genome map
AA seq 514 aa AA seqDB search
MLDSNIKQQLDTYLKNIINPIEITVSTNGTAKAEELLDLARDITSLNEKISLSVDETPTG
RAPLMAIGPKGEKARVQFAGIPMGHEFTSLVLALLQAGGHPAKESAETIEQAKSLSNKLN
FEIYISLTCQNCPEVVQALNLFAVLNPNVTTTMIDGALFQDEVNERNIMAVPSVYLNGEL
FGQGRMSLDEILNKVDTGASDKQAAALSEKAPYDVLVVGGGPAGASAAIYSARKGIRTGV
VADRFGGQVADTMAIENFISVKETEGPKLVANLEQHVLDYDVDLMKTQKAVRIEKNELIE
VELENGAVLKSKSVILATGARWREMNVPGENEYKGKGVAYCPHCDGPLFKGKKTAVIGGG
NSGIEAAIDLAGIVEHVTVLEFGDQLRADDVLVKKAESLSNVTIIKEAMTTEVIGDGQRV
IGLKYTDRKSGESHLVDVAGIFVQIGLVPNSEFLKDSLELTDRGEIVIDNRGQTSMPGVF
AAGDVTTQAYKQIIISMGAGATAALGAFDHLIRS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttagattcaaatataaagcaacaactggacacctatctaaagaacatcattaatccg
atcgagattactgtgtccactaacggcactgcaaaagcagaagagttactagatcttgct
cgtgatattacgagcctgaatgaaaaaatatccttatctgttgatgaaacgccaacagga
agagcacctttaatggcaattggccctaaaggtgaaaaagcgcgagttcaattcgcaggt
attccaatggggcacgagtttacgtctcttgttcttgccttattacaggctggcggacac
cctgcaaaagagtccgcagagaccattgaacaagctaaatcgctttcaaacaaactcaat
tttgaaatttatatttcactgacttgtcaaaactgtccagaagttgttcaggcacttaac
ttattcgcggtactgaaccccaatgtcacaacgacaatgattgatggcgccttattccaa
gacgaagttaatgaacgcaacataatggctgttccttctgtctatcttaatggcgagtta
ttcggacaaggcagaatgtcattagatgagattctaaataaagtagacactggcgcttcg
gataagcaagccgctgcgttgtctgaaaaagcaccttatgatgtgcttgtagtcggcggc
ggtccagcaggtgcctccgcagcaatttactcagctcgaaaaggcattcgtactggtgtc
gttgcagatcgctttggtggacaagttgccgatacaatggcaatcgagaactttatctct
gttaaagaaactgaagggccgaagctcgtcgcaaaccttgaacaacacgtattggactac
gatgtcgacttgatgaagacacaaaaagcagttcgtatcgagaaaaacgagttgatagaa
gtcgagctggaaaatggcgcagttctaaaaagtaaatccgttattcttgcaacgggtgct
cgctggagagaaatgaacgttcctggcgagaacgaatacaaaggcaaaggtgttgcttac
tgtccacactgtgatggcccattatttaaaggtaagaaaacagcagtcatcggcggcggt
aattcaggcatagaagcagccatcgatcttgctggaatcgtagaacatgtcacagtactt
gaatttggcgatcaacttcgggcagatgatgttctagttaaaaaagcagagtcgctatca
aacgttacgatcataaaagaggccatgacaactgaagttattggtgacgggcaacgtgtc
atcggcttgaaatatacagatcgtaaatcaggtgaatcacaccttgtcgatgttgcaggc
atttttgttcaaattggtttagttccgaacagcgagttcctaaaggactctctagaactg
acggatcgtggtgaaattgtaatcgacaatagagggcaaacatccatgccaggcgtattc
gctgctggcgatgtgaccacacaagcatacaaacagatcattatctcaatgggagctggc
gcaacagcggctcttggagcatttgatcacttaatcagaagctaa

DBGET integrated database retrieval system