KEGG   Marinomonas mediterranea: Marme_3875Help
Entry
Marme_3875        CDS       T01449                                 

Definition
(GenBank) Glutathione S-transferase domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mme  Marinomonas mediterranea
Pathway
mme00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Marme_3875
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mme02000]
    Marme_3875
Enzymes [BR:mme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Marme_3875
Transporters [BR:mme02000]
 Other Transporters
  Pores ion channels [TC:1]
   Marme_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_C_3 GST_N_2 GST_C_2 GST_C_6 GST_N_4 GST_N_5 Tom37
Motif
Other DBs
NCBI-ProteinID: ADZ93085
UniProt: F2JYF6
LinkDB All DBs
Position
complement(4275483..4276079)
Genome map
AA seq 198 aa AA seqDB search
MKIYGDIQSGNCYKVKLLTSLLDIEHEWIEVDILAKETHSASFLKMNPNGKIPLLELDDG
TFISESNAILNYLAYDSNLAGVCRFSKAKVLQWQFFEQYSHEPFIAVARFIAKYLGLPED
RKPEYEAKQAGGHKALKVMEEQLQSTLYLVGNDITIADISLYGYTHVAHEGGFDLSEYPA
IQKWIDRIQSHPNYISME
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatctatggggacattcaatcaggtaattgctacaaggtaaaactgcttacttca
cttctagatattgaacacgagtggatcgaagtggatatattggccaaagaaactcattca
gcgtcatttttgaaaatgaatccaaatggcaagataccgctccttgaattagatgatggt
acttttatttcagagtccaacgcgattctgaattacctcgcttatgactcaaacttagct
ggtgtttgccgtttcagcaaagccaaagtattgcagtggcaattttttgagcaatacagt
cacgaaccgtttattgccgtggctcgttttattgccaagtaccttgggttaccagaagat
cgtaagcctgagtatgaagctaagcaagcgggtggacataaagcattgaaggtgatggaa
gagcaattacaatcaacgctttatcttgtggggaatgacatcaccattgccgatatatct
ttgtatggttatacgcatgtcgcccatgaaggcggttttgatttgtctgagtacccagct
attcagaaatggatagaccgtattcaatctcatcctaactatataagtatggagtag

DBGET integrated database retrieval system