KEGG   Martelella mediterranea: Mame_01098Help
Entry
Mame_01098        CDS       T04757                                 

Gene name
glpD_3
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mmed  Martelella mediterranea
Pathway
mmed00564  Glycerophospholipid metabolism
mmed01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmed00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mame_01098 (glpD_3)
Enzymes [BR:mmed01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Mame_01098 (glpD_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C Pyr_redox_2 AlaDh_PNT_C GIDA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AQZ50469
UniProt: A0A1U9YYF3
LinkDB All DBs
Position
complement(1191132..1192634)
Genome map
AA seq 500 aa AA seqDB search
MSEPVDIFVIGGGVNGVGVARDAAGRGLTVALAEMHDLASATSSASTKLFHGGLRYLEYY
EFRLVREALIEREVLLKAMPHISWPMRFVLPHHKGLRPWWLVRLGLFLYDHLGGRKILPA
TKALDLSRDKAGKPLKSEYRRAFEYSDCWVQDARLVSLMARDAAKRGANIMTRTRVTGAE
QVTGEDGKTLWKVSLENAEGPLPPIHARALVNAGGPWVADLLKGAIGIDTREKVRLVRGS
HIVTRKLYDHDRCYFFQGSDGRIIFAIPYEQDFTLIGTTDQDHHGPARDAKCTPEEADYL
CRFASEYFERPVTTDDIVWTYSGVRPLYDDGASSATAATRDYVLSLRKEGAPLLSVFGGK
ITTHRKLAEAVIHKLSHYFPQAGGDWTATSTLPGGDFPVAETAAMPDRLARDYPFLDHAA
ALRLIRSYGSECWDLLGNAKTPADLGRHFGAGLYEAEVRWLMEKEFAKTAEDIVFRRTKR
GLRMSADEIAALDDRMNAAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacctgtcgacattttcgttatcggcggcggcgtcaacggcgtcggcgtggcg
cgtgatgccgcgggccgcggcctgaccgtcgcgctcgccgagatgcacgaccttgcctcg
gccacctcctcggcctcgaccaagctcttccacggcgggctccgctatctcgaatattat
gagttccggctggtccgcgaggcgctgatcgagcgcgaggtactgctgaaggcaatgcct
catatttcctggccgatgcgcttcgtgctgccgcaccacaagggcctgcgcccgtggtgg
ctggtgcggctcggcctgtttctctacgaccatctgggcggtcgcaagatcctgcccgcc
accaaggcgctcgatctttcccgagataaggccggcaaaccgctcaaaagcgaatatcgg
cgcgcattcgaatattccgactgctgggtgcaggatgcccggttggtatcgctgatggcg
cgcgatgccgcgaagcgcggcgcgaacatcatgacccggacgcgggtgaccggcgccgag
caggtgacaggtgaggacggcaagacgctgtggaaggtctcgctggaaaacgcggaaggc
ccgctgccgcccatccatgcccgcgcgctggtgaatgccggcgggccctgggtcgccgat
ctcctgaagggcgcgatcggcatcgacacgagggagaaggtccggctggtgcgcggcagc
catatcgtcacccgcaagctttacgaccatgatcgatgctactttttccagggctcggac
ggccggatcatcttcgccattccctatgagcaggatttcacgctcatcggcaccaccgac
caggaccatcacggcccggcgcgcgacgcgaaatgcacgcccgaggaggcggactatctt
tgccgcttcgcctcggaatatttcgaaaggccggtgacgaccgacgatatcgtctggacc
tattccggcgtccgcccgctttatgacgatggcgcgtcgtcggcgaccgccgcgacgcgg
gattacgtgctgtcgctgcgcaaggaaggcgcgccgctcttgagcgtcttcggcggcaag
atcaccacccatcgcaagctcgccgaagccgttatccacaagctgtcccattattttcca
caggctggcggcgactggacggcgacatcgacactgcccggcggcgactttccggtggcc
gaaacggcggccatgcccgacaggctcgcgcgcgattacccctttctcgaccatgccgca
gcacttcgcctgatccgcagctatggcagcgagtgctgggatttgctcggcaacgcaaaa
acgcccgccgatctcggccggcatttcggcgccgggctttacgaggcggaggtgcgctgg
ctgatggagaaggaatttgcgaaaactgcggaggatatcgtctttcgccgcaccaagcgc
ggccttaggatgagcgcggacgagatcgcggcgctggacgaccggatgaacgccgccggc
tga

DBGET integrated database retrieval system